BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H15 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. 23 4.5 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 23 4.5 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 23 4.5 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 5.9 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.9 >AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. Length = 196 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/51 (21%), Positives = 23/51 (45%) Frame = +1 Query: 94 TRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 246 T+ F+ LLA D + + + + RE++ +MY + + + G Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 23.4 bits (48), Expect = 4.5 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +1 Query: 295 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 417 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 229 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 276 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 23.4 bits (48), Expect = 4.5 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +1 Query: 295 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 417 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 246 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 293 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 163 KPTVSKTEIREKLAKMYKVTPDVVFVFGFK 252 KPT+ I EKL K K D V ++ F+ Sbjct: 49 KPTIHFAYIIEKLYKRLKSKGDYVGIYFFR 78 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 361 EKKRPTRKQRKERKNRMKKV 420 +KK PT+KQ K+ + ++ K+ Sbjct: 402 QKKLPTKKQHKQLQAQLDKL 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,801 Number of Sequences: 2352 Number of extensions: 11484 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -