BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H08 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) 127 6e-30 SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) 32 0.33 SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 28 5.4 SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) 28 7.1 SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) 28 7.1 SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) 27 9.4 SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) 27 9.4 >SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) Length = 600 Score = 127 bits (307), Expect = 6e-30 Identities = 59/98 (60%), Positives = 69/98 (70%) Frame = +2 Query: 53 KGNNMXPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPT 232 K NN+ PNGHFHKDWQR+VKTWF+QP R+ RR+ R LRPIVRCPT Sbjct: 4 KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQIKAAKIAPRPVAGSLRPIVRCPT 63 Query: 233 VRYHTKVRAGRGFTLREIRAAGLNPVFARTIGIAVDPR 346 +Y+TKVRAGRGFTL E++AAG+ A TIGIAVD R Sbjct: 64 FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHR 101 Score = 76.6 bits (180), Expect = 2e-14 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 2/92 (2%) Frame = +3 Query: 354 NKSVESLQINVQRIKEYRARLILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPK 530 N+S ESLQ NVQR+KEY+++LI+FP K K +G++ + A QL+GP+MP+ Q + Sbjct: 104 NRSAESLQANVQRLKEYKSKLIVFPRKANKPKQGDSEAADLANAVQLQGPVMPIPQESVP 163 Query: 531 SXARPITEXEKNFKAYQYLXGARSI-AKLVGI 623 ARPITE EK + + + + KLVG+ Sbjct: 164 IKARPITEDEKKSASSRQCESSGEVKTKLVGL 195 >SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) Length = 440 Score = 32.3 bits (70), Expect = 0.33 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 384 VQRIKEYRARLILFPKGKKVLKGEANEEERKLATQ 488 + RI+E R ++F GK V G +EE+ KLA + Sbjct: 319 IMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAAR 353 >SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -1 Query: 178 GLSFLYSILLSAVSSSWLVKPSFNKSLPILVEMSIRXHIIXLAHFDVGVLPRQRK 14 G F +IL+ A SS L++P F+ SLP+ + + L H P +RK Sbjct: 195 GFDFGKAILVKASLSSDLIRPGFDVSLPLFPKTHPHKDLGNLPH-SCSAFPLERK 248 >SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 430 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 345 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 220 +GS V ++T NP L++R N +P R +L+W++ G + Sbjct: 375 KGSWVALTVESSTLANPNILLARIQNLMPGRKASLLWFKATGKK 418 >SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) Length = 449 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 345 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 199 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 176 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 226 >SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) Length = 318 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 345 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 199 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 66 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 116 >SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) Length = 154 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 345 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 220 +GS A V +T NP L++R N +P R +L+W++ + Sbjct: 60 KGSWAALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEK 103 >SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) Length = 165 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 345 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 220 +GS V ++T NP L++R N +P R L+W++ G + Sbjct: 110 KGSWVALTVESSTLANPNILLARIQNLMPGRKALLLWFKATGKK 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,753,611 Number of Sequences: 59808 Number of extensions: 335278 Number of successful extensions: 827 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -