BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H04 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 1.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 1.2 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 25 2.8 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 3.7 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 3.7 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 24 4.8 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 24 4.8 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.8 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 6.4 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 6.4 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 6.4 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 8.4 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 8.4 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.2 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 586 CNSPADSCPSWYWNC 630 C +P SCP YW C Sbjct: 877 CRTPVMSCPQDYWLC 891 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.2 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 586 CNSPADSCPSWYWNC 630 C +P SCP YW C Sbjct: 877 CRTPVMSCPQDYWLC 891 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 595 PADSCPSWYWNCVCAS 642 PADSC YW+ C S Sbjct: 118 PADSCAGAYWSFRCYS 133 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +3 Query: 345 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 518 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +3 Query: 345 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 518 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 627 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGKTD 496 + +P +T+ E + QGTVC F + + TG D Sbjct: 35 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 78 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 627 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGKTD 496 + +P +T+ E + QGTVC F + + TG D Sbjct: 184 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 227 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 412 QQRSYWFGCEVQQGSRHCHSRR 477 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 637 RRHNSSTTRGRNQPDCYRTTLAGDLA 560 RR++SS+ + ++ D TTL D A Sbjct: 22 RRYSSSSYQDQSMDDALNTTLTNDKA 47 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 637 RRHNSSTTRGRNQPDCYRTTLAGDLA 560 RR++SS+ + ++ D TTL D A Sbjct: 22 RRYSSSSYQDQSMDDALNTTLTNDKA 47 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 646 RNWRRHNSSTTRGRNQPDCYR 584 + W H +T R P CYR Sbjct: 27 QGWYMHGRNTLRQMRWPPCYR 47 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 284 EFEIIDFFLGPSLNDEVLKIMPV 352 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 355 LYRHDL*NLIIQGRAEE 305 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,401 Number of Sequences: 2352 Number of extensions: 14167 Number of successful extensions: 46 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -