BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G17 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.72 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 2.9 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.6 bits (51), Expect = 0.72 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 434 KKQIWTLEPASGNANDSMIYLR 499 K W+L P SGN ++ YLR Sbjct: 210 KGSFWSLHPDSGNMFENGCYLR 231 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +1 Query: 1 CSPPRTAVGDASVYKNFTF*KFTGQYKPAIFFN 99 CSP + VG + FT Y P + N Sbjct: 257 CSPKKLIVGIPFYGRTFTLSNSNTNYNPGTYIN 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,767 Number of Sequences: 336 Number of extensions: 2957 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -