BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G17 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 6.4 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.4 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.4 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 380 LTAETFGFKINANGTSLKKKQIWTLEPASG 469 LTA I+ GT L KK LEP G Sbjct: 565 LTAPLGAILISVTGTKLLKKTKQQLEPLDG 594 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 292 RHCCVRSL*SFHTRAGLHRRRNAIARSRE 206 R+CC R F+ R L + +A+S E Sbjct: 99 RNCCTRQRKDFNPRKHLLKNVTGVAKSGE 127 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 292 RHCCVRSL*SFHTRAGLHRRRNAIARSRE 206 R+CC R F+ R L + +A+S E Sbjct: 99 RNCCTRQRKDFNPRKHLLKNVTGVAKSGE 127 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,170 Number of Sequences: 2352 Number of extensions: 11485 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -