BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G14 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 27 0.18 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 26 0.32 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 26 0.32 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 26 0.32 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 26 0.32 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 25 0.43 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 0.43 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 0.43 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.43 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.43 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.43 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.43 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.43 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.43 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 25 0.56 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 0.75 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 0.98 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 0.98 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 0.98 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 0.98 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.98 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 0.98 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 0.98 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 0.98 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 0.98 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 0.98 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 0.98 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 0.98 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 1.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.3 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 4.0 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 9.2 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 26.6 bits (56), Expect = 0.18 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDSKIDLRSRTKEERLQHRREVWLIQQERERE 52 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQI 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 329 NNYNNYNKHNYNKLYYNINYIEQI 352 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.8 bits (54), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + K +K+Y NI Y+ ++ Sbjct: 329 NNYNNYNKHNYNKLYYNINYIEQI 352 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.4 bits (53), Expect = 0.43 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ N K+Y NI Y+ ++ Sbjct: 95 NNYNNNYNNYNKKLYYNINYIEQI 118 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ +W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.43 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE-PKLK 298 +N+D K+D R+ K R+ W Q+R E KLK Sbjct: 19 RNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEKLK 57 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.0 bits (52), Expect = 0.56 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 5/68 (7%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTEPK--LKSL---YSDLMLHDKEEITYK 349 +N+D K+D R+ K R+ W Q+R E + +K + Y + + E++ + Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEYEIRRIREIEKLGSE 78 Query: 350 RFKSDGGD 373 R KS D Sbjct: 79 RSKSRSPD 86 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.6 bits (51), Expect = 0.75 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D K+D R+ K R+ W Q+R E Sbjct: 19 RNEDNKIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 0.98 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D+++D R+ K R+ W Q+R E Sbjct: 19 RNEDSEIDLRSRTKEERLQHRREAWLIQQERERE 52 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +2 Query: 17 NNYDTFMKLINS---KVYINIKYLHKV 88 NNY+ + N+ K+Y NI Y+ ++ Sbjct: 335 NNYNNYNNNYNNNYKKLYYNINYIEQI 361 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 11 EENNYDTFMKLINSKVYINI 70 EENN M++ N KV+I I Sbjct: 48 EENNMPNGMQIWNDKVFITI 67 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 185 KNDDAKVDFRTLEKPFRMNKLNLLWTKAQQRLTE 286 +N+D ++D R+ K R+ W Q+R E Sbjct: 19 RNEDNEIDLRSRTKEERLQHRREAWLIQQERERE 52 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 149 VCENKYTRSANEKNDDAKVDFRTLEKP 229 + NKY + AN + +V+FR L P Sbjct: 375 IVSNKYQKIANGDLNFNEVNFRILNAP 401 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 17 NNYDTFMKLINSKVYINIKYLHKV 88 NNY+ + KL Y NI Y+ +V Sbjct: 99 NNYNNYKKL-----YYNINYIEQV 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,800 Number of Sequences: 438 Number of extensions: 2457 Number of successful extensions: 42 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -