BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G13 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 26 0.25 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 22 4.1 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 22 4.1 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 9.4 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.8 bits (54), Expect = 0.25 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 276 LIMFSTCEQTVLTAASSFLD--PNHFSTFRRRGFTMRMSTAKCLKFLL 139 L+MFS + T PN ++ F + +T + KC+K+L+ Sbjct: 11 LLMFSYTDNVSSTRTKYLRTNFPNFYNDFEVQRYTWKCENQKCVKYLV 58 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -3 Query: 510 RAAELETSSKELPSMINSSFCLGELTTVTPGAIFTLLMYF 391 + A L + MIN +FC+ +L +T I + F Sbjct: 263 QVAALHIKLTDTAHMINYAFCVQQLLRITVAFISIVTALF 302 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -3 Query: 510 RAAELETSSKELPSMINSSFCLGELTTVTPGAIFTLLMYF 391 + A L + MIN +FC+ +L +T I + F Sbjct: 263 QVAALHIKLTDTAHMINYAFCVQQLLRITVAFISIVTALF 302 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 172 NVNSQVFKVPFENSAGPFN 116 N S FK+PF ++ P N Sbjct: 359 NFVSTFFKIPFYSTLRPIN 377 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,591 Number of Sequences: 336 Number of extensions: 2750 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -