BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G13 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 1.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.2 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 2.9 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 8.8 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 8.8 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.0 bits (52), Expect = 1.6 Identities = 19/98 (19%), Positives = 40/98 (40%) Frame = +2 Query: 221 KKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYI 400 + EL T + M++ + K + + H + V + +I++IRN+LG+ + Sbjct: 947 RDELIRYSTALRDLTQMMRDIRKSRFSHLHKLTTHMALR-VKHKFTNIMQIRNYLGKLRV 1005 Query: 401 RRVKMAPGVTVVNSPKQKDELIIEGNSLEDVSSSAALI 514 + + ++VV + SL S A + Sbjct: 1006 NQEECRLSLSVVPRDANVQNAVSTTKSLSGGERSYATV 1043 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 270 MFSTCEQTVLTAASSFLDPN 211 M S CE+T+ SSF DP+ Sbjct: 327 MISACEKTMQRMTSSFPDPH 346 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 24.2 bits (50), Expect = 2.9 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 501 ELETSSKELPSMINSSFCLGELTTVTPGAIFTLLMYFSPKKLRISIIELPSVVTQLMGK 325 E T +K + S++ F L P + L YF L++ + EL ++ +MGK Sbjct: 226 EQTTGAKAIISLVQKIFDLMYRLEFEPE--YVLWKYFQTPSLKLLMQELDNLTNLVMGK 282 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 288 LVTPLIMFSTCEQTVLTAASSFLDPNHFST 199 LVTP ++ + C+ L SFL H T Sbjct: 12 LVTPNLIVAECDTKGLIVEKSFLQSVHDCT 41 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 273 IMFSTCEQTVLTAASSFLDPN 211 IM +TC++T+ +S DP+ Sbjct: 263 IMLATCDKTMQRVTTSHSDPH 283 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,845 Number of Sequences: 2352 Number of extensions: 12348 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -