BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G11 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 294 5e-80 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 259 1e-69 SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 213 1e-55 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 154 7e-38 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 85 6e-17 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 81 8e-16 SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) 31 0.62 SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) 31 0.82 SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 29 2.5 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 294 bits (721), Expect = 5e-80 Identities = 135/170 (79%), Positives = 151/170 (88%) Frame = +3 Query: 141 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 320 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACET+ KTGM+LLCGEITS A Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSNA 88 Query: 321 NVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQ 500 VDYQ VVR+ +K IGYDDS KGFDYKTC+V++AL+QQS +IA GVH R +E+VGAGDQ Sbjct: 89 VVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDIAHGVHVGREEEDVGAGDQ 148 Query: 501 GLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVT 650 GLMFGYATDETEE MPLTVVLAHK+NQK+AE RR+G WARPDSKTQVT Sbjct: 149 GLMFGYATDETEELMPLTVVLAHKMNQKLAEYRRDGTLPWARPDSKTQVT 198 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 259 bits (635), Expect = 1e-69 Identities = 124/176 (70%), Positives = 137/176 (77%) Frame = +3 Query: 123 YDMEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCG 302 Y D FLFTSESV EGH DKMCDQISDA+LDAHL QDP AKVACET TKTG+VLL G Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQISDAVLDAHLEQDPYAKVACETATKTGLVLLFG 103 Query: 303 EITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEE 482 EITS A VDYQ VVR T++ IGY+DSS GFDYKTCSV+LA+ +Q IA VH NR D+E Sbjct: 104 EITSNARVDYQAVVRNTIRDIGYNDSSTGFDYKTCSVLLAIQEQVAEIAQTVHLNRRDDE 163 Query: 483 VGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVT 650 +GAGDQGLMFGYATDETEE MPLT VLAHKL ++AE R+ W PD KTQVT Sbjct: 164 IGAGDQGLMFGYATDETEELMPLTTVLAHKLCARLAECRKGKILPWLLPDGKTQVT 219 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 213 bits (519), Expect = 1e-55 Identities = 94/128 (73%), Positives = 114/128 (89%) Frame = +3 Query: 267 TITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNI 446 ++ KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+I Sbjct: 2 SVAKTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDI 61 Query: 447 AAGVHENRNDEEVGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWWAR 626 A GVH R+DE++GAGDQGLMFGYATDET+E MPLTVVLAH LN+++A+ RRNG W R Sbjct: 62 AQGVHIGRSDEDLGAGDQGLMFGYATDETDELMPLTVVLAHGLNKRLADCRRNGSLPWVR 121 Query: 627 PDSKTQVT 650 PDSKTQVT Sbjct: 122 PDSKTQVT 129 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 154 bits (373), Expect = 7e-38 Identities = 68/82 (82%), Positives = 77/82 (93%) Frame = +3 Query: 141 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 320 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACE++ KTGM+++CGEITS A Sbjct: 9 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACESVAKTGMIVVCGEITSLA 68 Query: 321 NVDYQKVVRETVKHIGYDDSSK 386 NVDYQKVVR+T+K IGYDDSSK Sbjct: 69 NVDYQKVVRDTIKQIGYDDSSK 90 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 84.6 bits (200), Expect = 6e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 141 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVAC 263 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVAC Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVAC 69 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 81.0 bits (191), Expect = 8e-16 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = +3 Query: 477 EEVGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVT 650 E+ GAGDQGLMFGYAT+ET+ MP V AH+L ++ +ELRRNG W RPD+K+QVT Sbjct: 8 EDQGAGDQGLMFGYATNETDSLMPAPVYYAHRLVERQSELRRNGTLPWLRPDAKSQVT 65 >SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) Length = 390 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 300 GEITSKANVDYQKVVRETV---KHIGYDDSSKGFDYK 401 GEITS N+D +K+ + K I YD G+DY+ Sbjct: 103 GEITSNVNIDREKLPGSNLLEFKAIAYDAKGAGYDYR 139 >SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) Length = 681 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 522 LHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGL 424 L N T+ P + PQ P H SHA + ++I G+ Sbjct: 99 LGNETARPAIAPQEPEHLVSHANKILTVIIQGM 131 >SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 25 RXTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 159 R VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 416 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 461 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 25 RXTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 159 R VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 70 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 115 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 268 VSHATFASGS*FRCASRIASLIWSHILSG 182 +S + A + FRC+ R S++W H+ +G Sbjct: 287 ISDSDLAKVASFRCSGRFPSIVWRHMTNG 315 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 72 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 248 MP G +K N + D D +L +S+ + D++C + I AHL QDPD Sbjct: 196 MPYGGGKRGKSKKNSSTLDTGDLETWLKGRKSITRVRNHDELCAARALVIGMAHLTQDPD 255 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 72 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 248 MP + G +K N + D D +L S+ + D++C + I AHL +DPD Sbjct: 241 MPFGAGKRGKSKKNSSTLDTGDLETWLKGKRSITRVRNHDELCAARATVIGMAHLTKDPD 300 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,727,345 Number of Sequences: 59808 Number of extensions: 517759 Number of successful extensions: 1409 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1408 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -