BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G09 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 40 2e-04 SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit... 29 0.44 SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces ... 28 1.0 SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces ... 28 1.0 SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharom... 27 3.1 SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|ch... 26 4.1 SPAC6G9.11 |syb1||synaptobrevin |Schizosaccharomyces pombe|chr 1... 25 7.2 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 40.3 bits (90), Expect = 2e-04 Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 5/59 (8%) Frame = +3 Query: 423 MSTSNANRPQVPLRQKDFDQI---WGDLQEGIEQVYKK--QYMVKRRYIDLYTHVYNYC 584 M+T N N +P+ +K +D + W L+ G+ Q++++ + M +Y++LYT ++NYC Sbjct: 1 MTTLNTNDKDLPIVKK-YDSLNGTWDFLKTGVSQIFERLDEGMTITKYMELYTAIHNYC 58 >SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 29.5 bits (63), Expect = 0.44 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 531 YMVKRRYIDLYTHVYNYCTSVHHHS 605 Y++ + Y+ YTH+Y Y +++H + Sbjct: 172 YVLTKSYLAKYTHIYRYYQTIYHQA 196 >SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces pombe|chr 3|||Manual Length = 546 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 200 YGSVFSCATACQFCLVFPLNLMALYFTLKALNELF 96 YG +F+ C C++F TL+ +NEL+ Sbjct: 433 YGYIFAACNLCAACIIFLFAHETKGLTLEEINELY 467 >SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 200 YGSVFSCATACQFCLVFPLNLMALYFTLKALNELF 96 YG +F+ C C++F TL+ +NEL+ Sbjct: 433 YGYIFAACNLCAACIIFLFAHETKGLTLEEINELY 467 >SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 26.6 bits (56), Expect = 3.1 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -3 Query: 218 FNALRHYGSVFSCATACQFCLVFPLNLMALYFTLKALNELFQTRLIIILRLVSA 57 F+ ++ G + +AC C++ N F L+A+NE + LR V A Sbjct: 576 FSLMKISGMAYPQCSACSECIINEWNREKWMFVLRAINEPDYVEELCGLREVQA 629 >SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 492 DLQEGIEQVYKKQYMVKRRYIDLYTHVYNY 581 D +G+E VYKK+YM KR D+ H+ ++ Sbjct: 145 DAVQGVE-VYKKKYMSKR---DIQEHIQDF 170 >SPAC6G9.11 |syb1||synaptobrevin |Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 496 FKRESNKFTKNSTWSRDDT*ICILTYTIIVRRFIIIAPVA 615 F+R +N+ K W +CI+ II+ +II P+A Sbjct: 77 FRRGANRVRKKMWWKDMRMRLCII-IGIIILLVVIIVPIA 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,452,608 Number of Sequences: 5004 Number of extensions: 48024 Number of successful extensions: 120 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -