BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G09 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50160.1 68418.m06212 ferric reductase-like transmembrane com... 29 2.0 At2g39440.1 68415.m04841 expressed protein 29 2.7 At5g27260.1 68418.m03252 hypothetical protein 29 3.6 At4g04020.1 68417.m00572 plastid-lipid associated protein PAP, p... 28 6.2 At3g44460.1 68416.m04779 basic leucine zipper transcription fact... 28 6.2 At4g02570.1 68417.m00351 cullin family protein similar to cullin... 27 8.2 >At5g50160.1 68418.m06212 ferric reductase-like transmembrane component family protein contains Pfam profile PF01794: Ferric reductase like transmembrane component Length = 728 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -2 Query: 198 RFGFLVRDCLSVLLSFPVKPNGTIFYIKSTK*AISNTFNHYIATG 64 RFG L CLS+LL FPV ++F + + + A S ++ + TG Sbjct: 158 RFGLLAEACLSLLL-FPVLRGLSMFRLLNIEFAASVKYHVWFGTG 201 >At2g39440.1 68415.m04841 expressed protein Length = 773 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 433 VMPTDPKCRCGKRTLIRYGAIFKRESNKFTKNSTWSRDD 549 V+ D C GKR L+ IF++ K+ ++W R D Sbjct: 632 VLLGDKNCVPGKRDLVITPKIFEKLEKKYYTETSWKRSD 670 >At5g27260.1 68418.m03252 hypothetical protein Length = 303 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +3 Query: 540 KRRYIDLYTHVYNYCTSVHHHSA 608 ++ Y+D + +VY Y T+ HH S+ Sbjct: 167 RKEYVDDFDNVYEYDTTTHHESS 189 >At4g04020.1 68417.m00572 plastid-lipid associated protein PAP, putative / fibrillin, putative strong similarity to plastid-lipid associated proteins PAP1 GI:14248554, PAP2 GI:14248556 from [Brassica rapa], fibrillin [Brassica napus] GI:4139097; contains Pfam profile PF04755: PAP_fibrillin Length = 318 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 435 NANRPQVPLRQKDFDQIWGDLQEGIEQVY 521 + +RP +R D D WG Q+G+E+V+ Sbjct: 46 SVHRPDFKIRATDIDDEWG--QDGVERVF 72 >At3g44460.1 68416.m04779 basic leucine zipper transcription factor (BZIP67) identical to basic leucine zipper transcription factor GI:18656053 from [Arabidopsis thaliana]; identical to cDNA basic leucine zipper transcription factor (atbzip67 gene) GI:18656052 Length = 331 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 453 VPLRQKDFDQIWGDLQEGIEQ 515 VPL +K D++W ++Q G++Q Sbjct: 103 VPLCKKTVDEVWLEIQNGVQQ 123 >At4g02570.1 68417.m00351 cullin family protein similar to cullin 3 [Homo sapiens] GI:3639052; contains Pfam profile PF00888: Cullin family Length = 738 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Frame = +3 Query: 471 DFDQIWGDLQEGIEQVYK------KQYMVKRRYIDLYTHVYNYCTSVHHH 602 D +Q W +Q GI ++ + + +Y+ LYT +YN CT H Sbjct: 7 DLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPH 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,215,456 Number of Sequences: 28952 Number of extensions: 226727 Number of successful extensions: 469 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -