BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G03 (478 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 2.5 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 21 5.8 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.2 bits (45), Expect = 2.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 210 KCKNIRRRPKAVVPRV 257 KC ++ RP+ VVP V Sbjct: 247 KCLSVGMRPECVVPEV 262 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.0 bits (42), Expect = 5.8 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 383 HRLTPRLEIPPPHRIH*KSHKFHYLLRMHLIESMLSFKISISHTRHHGFRATPYI 219 H+L I H + Y R HL+ + K+ S R + F+ T +I Sbjct: 75 HKLKLTNNISDKHGFTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFI 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,164 Number of Sequences: 336 Number of extensions: 1852 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -