BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G01 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 29 0.17 AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 23 6.4 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 8.5 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 8.5 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 8.5 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 8.5 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 8.5 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 8.5 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 28.7 bits (61), Expect = 0.17 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +2 Query: 452 CTPTIQQAMQPXNPGVCPPANQNPAP---ILTQNPNMGYGFPPLNTPNMPY 595 C +QP N PP ++ P P T P Y P N P PY Sbjct: 780 CVTNGDYMLQPSNAPFTPPTDRTPTPPPLPATAEPMGDYMIQPSNIPVHPY 830 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 501 QTPGXQG-CIACCIVGV 454 +T G G CIAC I+GV Sbjct: 72 KTTGNSGNCIACAIIGV 88 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 214 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 214 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 214 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 214 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 179 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 214 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 396 NGLLLSVFNDQLMSIDEDTVDFSNNYSSVMFISNTN 289 N +LS FND+ + +D+ + ++ +F+S +N Sbjct: 406 NSAVLSFFNDEKLYLDKSGLLKEADFHYDVFVSYSN 441 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,880 Number of Sequences: 2352 Number of extensions: 16445 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -