BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_G01 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34440.1 68417.m04894 protein kinase family protein contains ... 38 0.008 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 0.67 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 0.67 At3g60630.1 68416.m06784 scarecrow transcription factor family p... 31 0.67 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 31 0.67 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 30 1.2 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 29 2.7 At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain... 29 2.7 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 2.7 At1g70990.1 68414.m08190 proline-rich family protein 29 3.6 At4g10510.1 68417.m01723 subtilase family protein contains simil... 28 6.3 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 27 8.3 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 27 8.3 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 27 8.3 At3g58740.1 68416.m06547 citrate synthase, glyoxysomal, putative... 27 8.3 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 27 8.3 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 37.5 bits (83), Expect = 0.008 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 458 PTIQQAMQPXNPGVCPPANQNPAPILTQNPN--MGYGFPPLNTPNMPYYMSNQNP 616 P Q+ P +P PP NP+P +NP+ G P+ P P SNQ+P Sbjct: 61 PPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTPSNQSP 115 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.67 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +2 Query: 494 GVCPPANQNPAPILTQNPNMGYGFPPLNTPNMPYYMSNQNPYTGYGTQP 640 G PP P P Q P GY PP N P Y S Q GY T P Sbjct: 557 GKSPPPIAPPGPPAPQPPTQGY--PPSNQP-PGAYPSQQYATGGYSTAP 602 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.67 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +2 Query: 494 GVCPPANQNPAPILTQNPNMGYGFPPLNTPNMPYYMSNQNPYTGYGTQP 640 G PP P P Q P GY PP N P Y S Q GY T P Sbjct: 557 GKSPPPIAPPGPPAPQPPTQGY--PPSNQP-PGAYPSQQYATGGYSTAP 602 >At3g60630.1 68416.m06784 scarecrow transcription factor family protein scarecrow-like 6, Arabidopsis thaliana, EMBL:AF036303 Length = 623 Score = 31.1 bits (67), Expect = 0.67 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 542 NPNMGYGFPPLNTPNMPYYMSNQNPYTGYGTQP 640 NP GYGFP N P + + NP G+ + P Sbjct: 155 NPLFGYGFPFQNAPEEEKFQISINPNPGFFSDP 187 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 31.1 bits (67), Expect = 0.67 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 Query: 482 PXNPGVCPPANQNPAPILTQNPNMGYGFPPLNTPNMPYYMSNQNP 616 P + P +N NP P + NPN PP+ PN P SN NP Sbjct: 140 PPDSSSNPNSNPNP-PESSSNPN-----PPVTVPNPPESSSNPNP 178 Score = 30.7 bits (66), Expect = 0.89 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 503 PPANQNP-APILTQNPNMGYGFPPLNTPNMPYYMSNQNP 616 P ++ NP P + NPN PP+ PN P SN NP Sbjct: 103 PESSSNPNPPDSSSNPNSNPN-PPVTVPNPPESSSNPNP 140 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +2 Query: 500 CPPANQN-PAPILTQNPNMGYGFPPLNTPNMPYYM--SNQNPYTGYGTQ 637 CPP Q+ P P Q P+ +P +P+ PYY S+ P T Y TQ Sbjct: 571 CPPTTQSPPPPKYEQTPSPREYYP---SPSPPYYQYTSSPPPPTYYATQ 616 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +2 Query: 545 PNMGYGF---PPLNTPNMPYYMSNQNPYTGYGTQPQQAQ 652 P GYG+ PP PN YY YTGYG QQ Q Sbjct: 354 PQGGYGYAAQPPTQDPNA-YY----GGYTGYGNYQQQRQ 387 >At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein predicted proteins, Arabidopsis thaliana and Drosophila melanogaster contains Pfam profile PF00564: PB1 domain Length = 531 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 503 PPANQNPAPILTQNPNMGYGFPPLNTPNMP---YYMSNQN 613 P QNPAP+ Q P +GY N N+ Y ++QN Sbjct: 327 PTYTQNPAPVTNQQPPVGYWQGNTNNSNIQGNIYTTTSQN 366 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +2 Query: 458 PTIQQAMQPXNPGVCPPANQN--PAPILT---QNPNMG-YGFPPLNTPNMPYYMSNQNPY 619 PT +QP P PPAN N P+P T + P+ G P L +P+ NQ Sbjct: 174 PTNPPPIQPSGPATSPPANPNAPPSPFPTVPPKTPSSGPVVSPSLTSPSKGTPTPNQGNG 233 Query: 620 TGYG 631 G G Sbjct: 234 DGGG 237 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 446 LRCTPTIQQAMQPXNPGVCPPANQN---PAPILTQNPNMGYGFPPLNT 580 ++CTP +Q P P PP P P+ P Y PP +T Sbjct: 82 IKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPST 129 >At4g10510.1 68417.m01723 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 765 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 160 IIHNLPADTSYADVKSLIHSKCGLTDVILDNLMSQDNAGKKVTVGVTD 303 ++H +P D Y + GL+ NL++Q N G+++ +G+ D Sbjct: 89 VVHVIP-DRFYKPATTRTWDYLGLSPTNPKNLLNQTNMGEQMIIGIID 135 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 27.5 bits (58), Expect = 8.3 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 458 PTIQQAMQPXNPGVCPPANQNPAPILTQNPNMGYGFPPLNTPNMPYYMSNQNPYTGYGTQ 637 P +QQ QP PPA+ P P G+PP+ + P S+ P Y Q Sbjct: 173 PQVQQYPQPSG---YPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQ 229 Query: 638 P 640 P Sbjct: 230 P 230 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.5 bits (58), Expect = 8.3 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +2 Query: 458 PTIQQAMQPXNPGVCPPANQN--PAPILTQNPNMGYGFPPLNTPNMPYYMSNQNPYTGYG 631 P I + Q P + P Q P P Q P MG G PP P + P YG Sbjct: 145 PQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYG 204 Query: 632 TQP 640 +P Sbjct: 205 QRP 207 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.5 bits (58), Expect = 8.3 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +2 Query: 458 PTIQQAMQPXNPGVCPPANQN--PAPILTQNPNMGYGFPPLNTPNMPYYMSNQNPYTGYG 631 P I + Q P + P Q P P Q P MG G PP P + P YG Sbjct: 145 PQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYG 204 Query: 632 TQP 640 +P Sbjct: 205 QRP 207 >At3g58740.1 68416.m06547 citrate synthase, glyoxysomal, putative strong similarity to SP|P49299 Citrate synthase, glyoxysomal precursor {Cucurbita maxima}; contains Pfam profile PF00285: Citrate synthase Length = 480 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 145 ITMLLIIHNLPADTSYADVKSLIHSKCGLTDVILDNLMSQDN 270 +T LLI NLP+ AD + I + +LD + S N Sbjct: 135 VTYLLIYGNLPSQRQLADWEFAISQNSAVPQGVLDMIQSMPN 176 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 27.5 bits (58), Expect = 8.3 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 6/53 (11%) Frame = +2 Query: 479 QPXNPGVCPPANQNPAPILTQN---PNMGY-GF--PPLNTPNMPYYMSNQNPY 619 QP P PP +Q P P Q P MGY G+ PP PN P Q PY Sbjct: 27 QPPPP---PPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYPNYPNAPYQQYPY 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,343,672 Number of Sequences: 28952 Number of extensions: 305631 Number of successful extensions: 984 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -