BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F24 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.2 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.2 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +3 Query: 243 CDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQ 365 C+ G ++ + + DG PI+ N+ +E + +YQ Sbjct: 349 CNFEGNPIKTISWLKDGHPIDHNEAVLRIESVRKEDKGMYQ 389 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 2 ITTPSHKLSFTRSFVKTDTKSV 67 I TPS KLS RSF+ +V Sbjct: 31 INTPSFKLSKIRSFLNITASAV 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,717 Number of Sequences: 336 Number of extensions: 3018 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -