BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F22 (332 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1183.08c |rpl101|rpl1-1, rpl10a-1|60S ribosomal protein L10a... 23 9.2 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 23 9.2 SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces po... 23 9.2 >SPCC1183.08c |rpl101|rpl1-1, rpl10a-1|60S ribosomal protein L10a|Schizosaccharomyces pombe|chr 3|||Manual Length = 216 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 306 LGISVGHVVMSE 271 LG++VGHV MSE Sbjct: 164 LGVAVGHVEMSE 175 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 248 DAGSRPHHSDITTCPTEMPSTTSY 319 +AG RP I T E P+ T+Y Sbjct: 974 EAGIRPFVKQIDTVAAEFPAFTNY 997 >SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces pombe|chr 1|||Manual Length = 1159 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +3 Query: 138 GDSGTLAGDSTGSKTDSARQPGPARIASGRTPVPPXA 248 GD+ +G +G + P PA + TP P A Sbjct: 986 GDTAPASGFKSGFSFGANNSPQPASMFGTSTPAPSSA 1022 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,603 Number of Sequences: 5004 Number of extensions: 8311 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 93942212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -