BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F19 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34777| Best HMM Match : VWA (HMM E-Value=0) 29 2.5 SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +2 Query: 68 SSTEETSQLKAGHP--PAVKAGGMRITQ---HKTPHSKDSKEPANE 190 + + + SQ+ P P VK GM IT +TP+S+ SK+P N+ Sbjct: 391 NDSTDGSQISIAQPSTPLVKETGMHITPVNPPQTPNSQQSKQPVNK 436 >SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 496 TGCAPGLPGLHEQCRACVAVLPSKAIKHASWFV 594 TG PG +H+ C++C+A + H W V Sbjct: 502 TGTCPGSCSVHDTCKSCLA-WGVNHVPHCGWCV 533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,252,158 Number of Sequences: 59808 Number of extensions: 385322 Number of successful extensions: 993 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -