BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F19 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.4 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 4.4 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 5.9 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 5.9 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 5.9 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 7.8 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 502 CAPGLPGLHEQCRACVAVLPS 564 CAPG P + C+ CV L S Sbjct: 534 CAPGAPLDSKLCQQCVGNLAS 554 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 502 CAPGLPGLHEQCRACVAVLPS 564 CAPG P + C+ CV L S Sbjct: 534 CAPGAPLDSKLCQQCVGNLAS 554 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 502 CAPGLPGLHEQCRACVAVLPS 564 CAPG P + C+ CV L S Sbjct: 534 CAPGAPLDSKLCQQCVGNLAS 554 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -2 Query: 374 VLLSGLLDVWAWSEINVRWRLRTVG 300 +L++ L W+++N+RW + G Sbjct: 69 LLITNLWLKLEWNDVNMRWNVSDYG 93 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 282 PEAAQVAHSPKPPAHINLRPSPNIQ 356 P A Q+ H+P H P P ++ Sbjct: 454 PAAIQIGHTPHHHPHPPETPGPQVE 478 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 113 AVKAGGMRITQHKTPHSKDSKEPANEDLTGLS 208 A AG + I + P D++EP ++ L+G+S Sbjct: 492 ACTAGTLGII-FQAPSLYDTREPVDQQLSGIS 522 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 430 LTFSIPLLCINLLVIKC-AAFYFLGCWMFGLGL 335 ++ ++ L + +LV+ A+ LG W+FG+ L Sbjct: 76 VSLAVADLAVAILVMPFNVAYLLLGKWIFGIHL 108 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 430 LTFSIPLLCINLLVIKC-AAFYFLGCWMFGLGL 335 ++ ++ L + +LV+ A+ LG W+FG+ L Sbjct: 76 VSLAVADLAVAILVMPFNVAYLLLGKWIFGIHL 108 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 430 LTFSIPLLCINLLVIKC-AAFYFLGCWMFGLGL 335 ++ ++ L + +LV+ A+ LG W+FG+ L Sbjct: 76 VSLAVADLAVAILVMPFNVAYLLLGKWIFGIHL 108 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 477 IPTIILYFNILNFMIA 430 +P I YFN + FM+A Sbjct: 254 VPLIGSYFNCIMFMVA 269 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 477 IPTIILYFNILNFMIA 430 +P I YFN + FM+A Sbjct: 254 VPLIGSYFNCIMFMVA 269 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 477 IPTIILYFNILNFMIA 430 +P I YFN + FM+A Sbjct: 254 VPLIGSYFNCIMFMVA 269 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 477 IPTIILYFNILNFMIA 430 +P I YFN + FM+A Sbjct: 322 VPLIGSYFNCIMFMVA 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,844 Number of Sequences: 438 Number of extensions: 3537 Number of successful extensions: 24 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -