BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F18 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 317 4e-89 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.1 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.1 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 3.4 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 3.4 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 5.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 5.9 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 5.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 5.9 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 7.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 7.8 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 7.8 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 7.8 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 317 bits (779), Expect = 4e-89 Identities = 145/174 (83%), Positives = 159/174 (91%) Frame = +3 Query: 6 KYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRKTRIIDVVYNA 185 K+ELGRPAANT+LGPQRIH+VR+RGGN KYRALRLDTGNFSWGSEC+TRKTRIIDVVYNA Sbjct: 26 KFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRKTRIIDVVYNA 85 Query: 186 SNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQKT 365 SNNELVRTKTLVKNAIV +DATPFRQWYE HY LPLGRK+GAKLTEAEE ++NKKRS+K Sbjct: 86 SNNELVRTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRGAKLTEAEEEVLNKKRSKKA 145 Query: 366 ARKYLARQRLAKVEGALXEQFHTGRLLACVASRPGQCGRADGYILXGKELEFYL 527 KY ARQR AKVE AL EQF TGR+LAC++SRPGQCGR DGYIL GKELEFY+ Sbjct: 146 EAKYKARQRFAKVEPALEEQFATGRVLACISSRPGQCGREDGYILEGKELEFYM 199 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 239 YNNCILDKGLCT 204 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 239 YNNCILDKGLCT 204 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 239 YNNCILDKGLCTHQ 198 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 239 YNNCILDKGLCTHQ 198 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 272 LIPLPEWSCIYYNNC 228 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 239 YNNCILDKGLCT 204 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +3 Query: 150 RKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQ 263 RK + +VVY N + + V + I ++ A+P ++ Sbjct: 358 RKRPMHNVVYRPGENPVTQRLPAVLSRIGIILASPLKR 395 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 239 YNNCILDKGLCT 204 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 239 YNNCILDKGLCT 204 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,787 Number of Sequences: 438 Number of extensions: 2832 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -