BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F10 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 60 1e-11 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 5.0 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.7 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 21 6.7 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 60.5 bits (140), Expect = 1e-11 Identities = 31/90 (34%), Positives = 57/90 (63%), Gaps = 9/90 (10%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 584 FE L+ LL + + G+ KP+ IQ+ +IP+ LSG+D+++ A+ G+GKT A+ +P++ Sbjct: 160 FETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMSCAQTGSGKTAAFMLPIIHN 219 Query: 585 V-------DPKKDTIQALIVV--PTRELAL 647 + + + + Q ++V+ PTRELA+ Sbjct: 220 LLSDKNPPNTENNCAQPVVVIMSPTRELAI 249 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 345 IPPKDRRIKTSDVTDTRGNEFEEFCLKR 428 I K R ++ D+ GN EEF L R Sbjct: 185 ISDKAARPRSLQFVDSEGNILEEFVLSR 212 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/28 (25%), Positives = 16/28 (57%) Frame = +3 Query: 567 IPVLEQVDPKKDTIQALIVVPTRELALP 650 +P+L++ PK+D + + P ++ P Sbjct: 1 MPLLQETTPKRDMLDSQEKTPLSSVSYP 28 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 200 LKLETYNHTNYYLSK 156 L+LE HTN+YL++ Sbjct: 236 LELEKEFHTNHYLTR 250 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 200 LKLETYNHTNYYLSK 156 L+LE HTN+YL++ Sbjct: 18 LELEKEFHTNHYLTR 32 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,886 Number of Sequences: 336 Number of extensions: 2284 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -