BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F10 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 179 2e-45 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 179 2e-45 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 81 8e-16 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 78 7e-15 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 73 2e-13 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 69 3e-12 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 67 1e-11 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 60 2e-09 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 58 6e-09 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 56 2e-08 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 56 3e-08 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 52 4e-07 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 50 2e-06 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 48 7e-06 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 41 0.001 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 40 0.001 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 35 0.066 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) 30 1.4 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 28 5.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40761| Best HMM Match : UPF0020 (HMM E-Value=9.5e-06) 28 7.6 SB_30915| Best HMM Match : cNMP_binding (HMM E-Value=6.3e-10) 28 7.6 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 179 bits (435), Expect = 2e-45 Identities = 79/107 (73%), Positives = 96/107 (89%) Frame = +3 Query: 327 WKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIAL 506 WK+ LK+PPKD R KTSDVT T+GNEFE++CLKRELLMGIFEKG++KPSPIQE SIP+AL Sbjct: 23 WKANLKLPPKDNRFKTSDVTATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVAL 82 Query: 507 SGKDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELAL 647 +G+D+LARAKNGTGKT AY +P+LE+ D K+ IQAL++VPTRELAL Sbjct: 83 AGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELAL 129 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 179 bits (435), Expect = 2e-45 Identities = 79/107 (73%), Positives = 96/107 (89%) Frame = +3 Query: 327 WKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIAL 506 WK+ LK+PPKD R KTSDVT T+GNEFE++CLKRELLMGIFEKG++KPSPIQE SIP+AL Sbjct: 23 WKANLKLPPKDNRFKTSDVTATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVAL 82 Query: 507 SGKDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELAL 647 +G+D+LARAKNGTGKT AY +P+LE+ D K+ IQAL++VPTRELAL Sbjct: 83 AGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELAL 129 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 81.0 bits (191), Expect = 8e-16 Identities = 40/93 (43%), Positives = 59/93 (63%) Frame = +3 Query: 369 KTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTG 548 +T+DV +F L LL G+ E G+EKPSPIQ +IP+ G D++A+AK+GTG Sbjct: 3 RTTDVLIEEQIDFHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTG 62 Query: 549 KTGAYCIPVLEQVDPKKDTIQALIVVPTRELAL 647 KT + + LE V + + IQ +I+ PTRE+A+ Sbjct: 63 KTCVFSVIALENVITESNCIQIIILTPTREIAV 95 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 77.8 bits (183), Expect = 7e-15 Identities = 39/101 (38%), Positives = 63/101 (62%), Gaps = 4/101 (3%) Frame = +3 Query: 354 KDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARA 533 KD + ++ + +F +F + + L G+ + G+ P+ IQ+ IP+ALSG+DVL A Sbjct: 35 KDLEDRCKEIGSSEVEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAA 94 Query: 534 KNGTGKTGAYCIPVLEQVDPKK----DTIQALIVVPTRELA 644 K G+GKT A+ IP++E + +K D + AL++ PTRELA Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELA 135 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/80 (41%), Positives = 50/80 (62%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 584 F +F LK ELL I + G+E PS +Q IP A+ G D++ +AK+G GKT + + L+Q Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATLQQ 108 Query: 585 VDPKKDTIQALIVVPTRELA 644 ++P + L++ TRELA Sbjct: 109 LEPVDGQVSVLVMCHTRELA 128 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/80 (41%), Positives = 50/80 (62%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 584 F +F LK ELL I + G+E PS +Q IP A+ G D++ +AK+G GKT + + L+Q Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATLQQ 108 Query: 585 VDPKKDTIQALIVVPTRELA 644 ++P + L++ TRELA Sbjct: 109 LEPVDGQVSVLVMCHTRELA 128 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = +3 Query: 450 EKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQV---DPKKDTIQALI 620 E G+ P+PIQ ++IP+AL GKDV A A GTGKT A+ +P+LE++ + I+ L+ Sbjct: 27 ELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLV 86 Query: 621 VVPTRELAL 647 + PTRELA+ Sbjct: 87 ITPTRELAI 95 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 68.5 bits (160), Expect = 4e-12 Identities = 32/64 (50%), Positives = 47/64 (73%) Frame = +3 Query: 453 KGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPT 632 +G+EKPS IQ+ +I L G+DV+A+A++GTGKT + I VL+ +D + QAL++ PT Sbjct: 15 EGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPT 74 Query: 633 RELA 644 RELA Sbjct: 75 RELA 78 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 67.7 bits (158), Expect = 8e-12 Identities = 34/86 (39%), Positives = 54/86 (62%), Gaps = 6/86 (6%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 584 F E +L+ I G+ +P+P+Q+A++PI ++G+D++A A+ G+GKT AY +PVL Sbjct: 481 FNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGKTAAYMLPVLTS 540 Query: 585 V------DPKKDTIQALIVVPTRELA 644 + P + + AL V PTRELA Sbjct: 541 LIKQGLNAPPRSPL-ALCVAPTRELA 565 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 66.9 bits (156), Expect = 1e-11 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 4/109 (3%) Frame = +3 Query: 330 KSKLKIPPKDRRIKTSDVTDT--RGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIA 503 + KL + + + SD + FEE L L G+++ G+ KPS IQE ++P+ Sbjct: 78 RDKLVVTKHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPML 137 Query: 504 LSGKDV--LARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELA 644 L+ V +A++++GTGKT A+ + +L +VD K Q + + PT ELA Sbjct: 138 LADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELA 186 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 66.1 bits (154), Expect = 2e-11 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 9/91 (9%) Frame = +3 Query: 399 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVL 578 N FEE L L + + ++KP+P+Q+ SIPI ++G+DV+A A+ G+GKT A+ +PV+ Sbjct: 711 NSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTAAFLLPVM 770 Query: 579 EQV---------DPKKDTIQALIVVPTRELA 644 + + T QA+ + PTRELA Sbjct: 771 TSMMNAGLTSSSFSETQTPQAMCIAPTRELA 801 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 59.7 bits (138), Expect = 2e-09 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 5/118 (4%) Frame = +3 Query: 303 DKSIDDVGWKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQ 482 D+ +D++ WK+ + I +D F + L EL + +K ++ P+PIQ Sbjct: 48 DEVVDEIRWKNGIHIEGED--------CPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQ 99 Query: 483 EASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQVDPKK-----DTIQALIVVPTREL 641 S+ +SG+D++ A+ G+GKT AY +P+ + K DT ALI+ PTREL Sbjct: 100 MQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTREL 157 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 58.0 bits (134), Expect = 6e-09 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 20/146 (13%) Frame = +3 Query: 267 VGNSISQTKGEVDK-SIDDVGWKSKL--KIPPKDRRIKTSDVT-DTRGN-------EFEE 413 + N + + K + K + DD W K ++ +D RI D T+G +++E Sbjct: 46 IRNRLKKEKDKERKVAFDDRHWTKKNLEEMTERDWRIFREDFNISTKGGRIPFPIRKWKE 105 Query: 414 FCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPV------ 575 + +L + + G++ P+PIQ +IPI L +D++ A+ G+GKT A+ IP+ Sbjct: 106 AQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMG 165 Query: 576 LEQVDPKKDTIQ---ALIVVPTRELA 644 L +++ D Q ALI+ PTRELA Sbjct: 166 LPKIERDNDADQGPYALILAPTRELA 191 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 56.8 bits (131), Expect = 1e-08 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 28/108 (25%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIP----------------------IALSGKD 518 F++ LK LL GI+ G+EKPS IQ+ +I LS +D Sbjct: 65 FDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQLNLTKNHYVLSARD 124 Query: 519 VLARAKNGTGKTGAYCIPVLEQVDPKK------DTIQALIVVPTRELA 644 V+A+A++GTGKT + I +L+++D D QAL++ PTRELA Sbjct: 125 VIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELA 172 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/75 (37%), Positives = 45/75 (60%) Frame = +3 Query: 420 LKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQVDPKK 599 L + L+ G +KP+ IQ +P L G+D + AK G+GKT A+ +P+L+++ Sbjct: 14 LNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDP 73 Query: 600 DTIQALIVVPTRELA 644 I A+++ PTRELA Sbjct: 74 YGIFAVVLTPTRELA 88 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = +3 Query: 489 SIPIALSGKDVLARAKNGTGKTGAYCIPVLE--QVDPKKDTIQALIVVPTRELAL 647 ++P+ + GKDV+A A+ G+GKT A+ IP+ E Q K I+ALI+ PTRELAL Sbjct: 311 TLPLVMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELAL 365 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/81 (38%), Positives = 49/81 (60%) Frame = +3 Query: 402 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLE 581 EF F + +L+ + + G KP PIQE ++P S K +L +++ GTGK+ + +P ++ Sbjct: 161 EFSNFGVHPKLVEKLKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPSVQ 220 Query: 582 QVDPKKDTIQALIVVPTRELA 644 DP + +IVVPTRELA Sbjct: 221 --DPGRG-YGTIIVVPTRELA 238 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/62 (38%), Positives = 42/62 (67%) Frame = +3 Query: 402 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLE 581 +FE+ L LL + G++KP+P+Q+ +IPI +D++A A+ G+GKT A+ IP+L Sbjct: 876 QFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILS 935 Query: 582 QV 587 ++ Sbjct: 936 RI 937 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 52.8 bits (121), Expect = 2e-07 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%) Frame = +3 Query: 405 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 584 F F +++ I + + +P+ IQ ++PIALSG+D++ AK G+GKT A+ P L Sbjct: 519 FAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVH 578 Query: 585 V--DPK---KDTIQALIVVPTREL 641 + P+ D LI PTREL Sbjct: 579 IMDQPELQVGDGPIVLICAPTREL 602 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +3 Query: 399 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKT 554 N FEE L L + + ++KP+P+Q+ SIPI ++G+DV+A A+ G+GKT Sbjct: 134 NSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKT 185 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 51.6 bits (118), Expect = 5e-07 Identities = 24/67 (35%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +3 Query: 402 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALS-GKDVLARAKNGTGKTGAYCIPVL 578 E+E + ++L + ++G+ KP+PIQ SIP AL +D++ A+ G+GKT A+ IP++ Sbjct: 131 EWEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPII 190 Query: 579 EQVDPKK 599 + ++ K Sbjct: 191 QHIEAYK 197 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 51.2 bits (117), Expect = 7e-07 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 5/81 (6%) Frame = +3 Query: 420 LKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLE-----Q 584 + + L GI + G+ + IQ SI L G+D+L AK G+GKT A+ +PV+E Q Sbjct: 579 VSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQ 638 Query: 585 VDPKKDTIQALIVVPTRELAL 647 + T +I+ PTREL+L Sbjct: 639 FKTRNGT-GVIIISPTRELSL 658 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/90 (28%), Positives = 51/90 (56%), Gaps = 6/90 (6%) Frame = +3 Query: 393 RGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIP 572 R +F +F + ++ + + ++G PIQ ++ G+DV+ +A+ GTGKT ++ +P Sbjct: 71 REGDFSKFRISQKTIDNLEDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALP 130 Query: 573 VLEQVDPKK------DTIQALIVVPTRELA 644 ++E++ K + L++ PTRELA Sbjct: 131 LVEKLQDGKLSQKRGRAPKVLVMAPTRELA 160 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +3 Query: 513 KDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELA 644 KDV+ A+ G+GKTGA+ +P+L+ + + ALI+ PTRELA Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELA 45 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 40.7 bits (91), Expect = 0.001 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 9/141 (6%) Frame = +3 Query: 249 ISSSNHVGNSISQTKGEVDKSIDDVGWKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKR 428 ++SSN ++S KGE + +I+ VG ++ P D + R F L+ Sbjct: 337 MASSNLPEATVS--KGEKEVTIEAVG-QNPAFTPDSDMAFRQ------RVYSFAGLGLRD 387 Query: 429 ELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQV--DPKKD 602 ++L + +P+ IQ +IP + V+ A+ G+GKT AY P++ ++ D ++ Sbjct: 388 DVLKALDALNIHQPTVIQMVTIPKIIHRHHVICAAQTGSGKTLAYLAPLVHRLREDEERH 447 Query: 603 TI-------QALIVVPTRELA 644 I +A IVVP RELA Sbjct: 448 GILARLKRPRACIVVPARELA 468 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +3 Query: 402 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGK 551 EF L + G+ P+PIQ +P+ LSG+DV+ A G+GK Sbjct: 197 EFFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGK 246 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 34.7 bits (76), Expect = 0.066 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +3 Query: 450 EKGWEKPSPIQEASIPIALSGKDVLA 527 + +EKP+PIQ +IP+ +SG+D++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 30.7 bits (66), Expect = 1.1 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 4/123 (3%) Frame = +3 Query: 291 KGEVD--KSIDDVGWKSKLKIP-PKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGW 461 +G++D + + V K+ + P KD ++ ++ E +EF L E I +G Sbjct: 42 EGDIDAMEELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLE---NIHVRGK 98 Query: 462 EKPSPIQE-ASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRE 638 P P++ A + L DVL KN K + + +D I A+++ PTRE Sbjct: 99 NAPKPVKTWAQTGVQLKILDVLK--KNSYEKPTPIQAQAIPVIMSGRDMI-AIVMTPTRE 155 Query: 639 LAL 647 LA+ Sbjct: 156 LAI 158 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 34.7 bits (76), Expect = 0.066 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 468 PSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQV 587 P+ +Q+ P L G+DV A G+GK AY +P++ Q+ Sbjct: 210 PTSLQKHMWPSLLRGRDVAGVAIEGSGKRLAYLLPIIHQI 249 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +3 Query: 399 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIA-LSGKDVLARAK 536 +E+E + ++L + ++G+ KP+PIQ SIP A L +D++ A+ Sbjct: 72 SEWEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAE 118 >SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) Length = 304 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 474 PIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVL 578 P+Q +I L+ KD L G GKT Y IP L Sbjct: 142 PMQRQAIDTLLAEKDSLILLPTGAGKTICYAIPAL 176 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 28.3 bits (60), Expect = 5.7 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Frame = +3 Query: 444 IFEKGWEKPSPIQEASIPIALSG-KDVLARAKNGTGKTGAYCIPV----LEQVDPKKDTI 608 I+ KG + P P++ S I G D + G T I + L PKK Sbjct: 147 IYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPLMAHGPKKSGF 206 Query: 609 QALIVVPTRELA 644 +A++V PTRELA Sbjct: 207 RAVVVSPTRELA 218 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -3 Query: 556 PVLPVPFLALASTSFPLRAIGIEAS*IGDGFSHPFS-KI-PINNSRFKQNSSNSLP 395 P+LP L ++ +PLR+ + G ++ + +I P NSR QNS NSLP Sbjct: 480 PILPTKRLLAVNSQYPLRSQAPQKQ-PGYFYNLDYQGRINPATNSRQTQNSLNSLP 534 >SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 505 RAIGIEAS*IGDGFSHPFSKIPINNSRFKQNS 410 RA+G+ ++ +G G S PF+ I +NN R N+ Sbjct: 476 RAVGLASADLG-GASDPFAVIEVNNQRLVTNT 506 >SB_40761| Best HMM Match : UPF0020 (HMM E-Value=9.5e-06) Length = 1176 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 354 KDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKD 518 KD+ T+D +DT G +E C+ + + G K + AS +A GK+ Sbjct: 881 KDKDDNTTDTSDTTGGGNKEACIGADSVDSAECDGAGKGEGLDAASKEVACEGKE 935 >SB_30915| Best HMM Match : cNMP_binding (HMM E-Value=6.3e-10) Length = 673 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 240 ENRISSSNHVGNSISQTKGEVDKSIDDVGWKSKLKIPPKDRRIKTSDVTDTR 395 E R+ SSN + ++ T+GE++ I + + + PK R ++ T R Sbjct: 309 EPRVPSSNAESSPVTTTRGEMETKIKPMSAPGRCRGAPKSLRDASNSPTRNR 360 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,164,208 Number of Sequences: 59808 Number of extensions: 282401 Number of successful extensions: 697 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -