Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_F08
         (440 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    22   2.2  
AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone recepto...    22   3.0  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -1

Query: 332 IFYFFFYHCWFC 297
           I+YF++ H  FC
Sbjct: 258 IYYFYYMHLLFC 269


>AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone receptor
           (isoform B) protein.
          Length = 96

 Score = 21.8 bits (44), Expect = 3.0
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = -2

Query: 379 MSRSWRTTFSLPASNKSFTSSSITVGSASLSLDS 278
           M R W    +   S+   TSSS  V S + SL S
Sbjct: 1   MKRRWSARVAPEESSSEVTSSSALVMSPANSLAS 34


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,446
Number of Sequences: 336
Number of extensions: 1403
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used:  9880622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)