BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_F04 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) 169 1e-42 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 30 1.0 SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) 29 1.8 SB_30003| Best HMM Match : DUF906 (HMM E-Value=0) 28 4.1 SB_31497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) 27 7.2 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) Length = 166 Score = 169 bits (411), Expect = 1e-42 Identities = 76/103 (73%), Positives = 90/103 (87%), Gaps = 1/103 (0%) Frame = +1 Query: 40 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 219 ML+PK+NRV IYEYLFKEGV VAKKD+++PKHT++E +PNL VIKA+QSLKSRGYV+E+F Sbjct: 1 MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVPNLHVIKALQSLKSRGYVEEKF 60 Query: 220 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSV-RTETVR 345 W+H+YW LTNEGI YLR FLHLP EIVPATL+R V R ET R Sbjct: 61 CWKHYYWNLTNEGITYLRDFLHLPTEIVPATLRRQVTRAETAR 103 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +2 Query: 410 RTPAAPGVAPHDK-KADVGPGS 472 +TPA PG+AP D K VGPG+ Sbjct: 365 KTPALPGIAPSDALKGTVGPGN 386 >SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) Length = 585 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 419 AAPGVAPHDKKADVGP 466 A PG+APHDKK+ GP Sbjct: 545 ARPGLAPHDKKSGKGP 560 >SB_30003| Best HMM Match : DUF906 (HMM E-Value=0) Length = 2276 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = -1 Query: 497 SLP*IQDQLSLDQHQPFYHEV---QHQGQQEYVCMQICPQQSGLGHQDDQXGPRRTVSVR 327 S P +Q +S Q QP H++ Q QQ++ Q+ QQ Q Q P+ + S+ Sbjct: 664 SAPQLQSSMSSQQQQPQQHQISAQQQLQQQQHQQQQLLQQQQ---QQQSQMPPQSSQSMT 720 Query: 326 TERLSVAGTISGGRCKN 276 + + G+ KN Sbjct: 721 GGQNNTQSLTGQGQGKN 737 >SB_31497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = -1 Query: 503 VHSLP*IQDQLSLDQHQPFYHEVQHQGQQEYVCMQICPQQSGLGHQD 363 VH P + D + + QH +V HQ C ICPQ GL QD Sbjct: 208 VHQHPGLVDPV-VHQHPGLVDQVVHQHPGP--CDPICPQHPGLVDQD 251 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/75 (28%), Positives = 32/75 (42%) Frame = -1 Query: 479 DQLSLDQHQPFYHEVQHQGQQEYVCMQICPQQSGLGHQDDQXGPRRTVSVRTERLSVAGT 300 D+ D H+ + HE + QG E +C CP+ + H++ P R V V Sbjct: 978 DESEEDGHEDYCHECE-QGGDELICCDGCPR---VYHRECHHPPLRYV---PRGSWVCSG 1030 Query: 299 ISGGRCKNILKYSIP 255 + KN LK +P Sbjct: 1031 CKNPKKKNTLKLPVP 1045 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 64 VAIYEYLFKEGVMVAKKDYHAPKHTELEKIPN 159 +A +++L K + + APK +EK+PN Sbjct: 1395 IADFDFLSKSAIQALRLPVPAPKVNNMEKVPN 1426 >SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) Length = 578 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +1 Query: 112 KDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLP 291 +DY A T I + ++ + + SRG+VK+ +A+ W + + +L +L L Sbjct: 118 EDYDASGGTVY--ITAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLS-YLSLA 174 Query: 292 PEIVPATLKRSVR 330 P+I + R++R Sbjct: 175 PDIASLSGIRTLR 187 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 Query: 359 GRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 472 G P+ + S+E R RT AP P K PG+ Sbjct: 6325 GEPEGTSPSSESRIPVGRTTKAPTTKPASKTTTTRPGT 6362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,248,698 Number of Sequences: 59808 Number of extensions: 316101 Number of successful extensions: 859 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -