BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E20 (572 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807,187... 32 0.28 01_06_0866 - 32572002-32572541,32572806-32572984,32574330-325744... 29 3.5 01_06_0605 + 30548588-30548732,30549004-30549094,30549470-305495... 29 3.5 02_02_0096 - 6727844-6727957,6728149-6728247,6728332-6728410,672... 28 6.1 12_02_0019 - 12366259-12366819,12367653-12367685,12368294-123683... 27 8.0 >04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807, 1876750-1876812 Length = 233 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 363 PETRVNVTGASGNSMSRRTCLDSPTFNTATGSFTASCSDMASTCIT 226 P T + T A S S + C DSPT +T++G T + S T Sbjct: 4 PTTSYSTTSAMERSNSTKRCSDSPTVSTSSGRVTTTAWSSTSGAAT 49 >01_06_0866 - 32572002-32572541,32572806-32572984,32574330-32574430, 32574554-32574887,32574915-32575037,32575193-32575394, 32575915-32576097,32576332-32576436,32576553-32576760, 32577025-32577170,32577321-32577443,32577490-32577698, 32577931-32578152,32578189-32578198,32578710-32578763, 32580841-32581052,32581620-32581772,32582071-32582158, 32582192-32582290,32582660-32582907,32584806-32585049 Length = 1260 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -3 Query: 351 VNVTGASGNSMSRRTCLDSPTFNTATGSFTASCSDMASTCITFNSSGLASG 199 V + G G + R SP F G+ +C D A+ + + SG+A G Sbjct: 1140 VRLAGYEGIDLGRPAATVSPEFRVTLGTANGACVDRAAVTVLY--SGVALG 1188 >01_06_0605 + 30548588-30548732,30549004-30549094,30549470-30549536, 30550664-30550778,30550939-30551042 Length = 173 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 291 LVNQGMYVWTLNSQMRLLHLLLFQGF--GASTLNWTPSPWC 407 L N+G YV++ + + H+L+F G G N PWC Sbjct: 112 LPNRGNYVFSDQTLETIGHILVFPGIPAGEKYFNQLSKPWC 152 >02_02_0096 - 6727844-6727957,6728149-6728247,6728332-6728410, 6728534-6728634,6728740-6728808,6729180-6729220, 6729992-6730836,6730924-6731027,6731479-6732354 Length = 775 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = +2 Query: 176 VIRQALLGPDAKPDELNV---IQVEAMSLQE-AVKLPVAVLKVGESRH 307 ++ A+ GP DE+N ++ A+ LQ ++ LP+ +L++G SRH Sbjct: 239 LVVDAMGGPVDDADEMNREWGVKSRALCLQRNSIVLPLGLLRIGLSRH 286 >12_02_0019 - 12366259-12366819,12367653-12367685,12368294-12368363, 12368582-12368712,12369627-12369673,12369803-12369879, 12369963-12370027,12370105-12370191,12370300-12370389, 12370972-12371037,12371608-12371664,12371749-12371850, 12373018-12373554 Length = 640 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 484 FKDEDNEXGEPKGKKAKMSNNAKG 555 F D + E G KG++ K+S N +G Sbjct: 524 FSDSEAEDGSSKGRREKVSRNVEG 547 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,831,531 Number of Sequences: 37544 Number of extensions: 222288 Number of successful extensions: 584 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -