BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E20 (572 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14850.1 68415.m01687 expressed protein 31 0.72 At1g66040.1 68414.m07495 zinc finger (C3HC4-type RING finger) fa... 29 2.2 At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 29 2.9 At3g58050.1 68416.m06471 expressed protein 28 3.8 At5g39550.1 68418.m04791 zinc finger (C3HC4-type RING finger) fa... 28 5.1 At4g33890.2 68417.m04809 expressed protein 28 5.1 At4g33890.1 68417.m04808 expressed protein 28 5.1 At1g59860.1 68414.m06742 17.6 kDa class I heat shock protein (HS... 27 6.7 >At2g14850.1 68415.m01687 expressed protein Length = 291 Score = 30.7 bits (66), Expect = 0.72 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 161 RSNKLVIRQALLGPDAKPDELNVIQVEAMSLQEAVKLPVAVLKVGESRHV 310 RS K R + LGP KP L E+MS +A +LP+ V+ V + V Sbjct: 104 RSRKFRDRPSPLGPLGKPQSLTTTNDESMS--KAQRLPMEVVSVEDGEEV 151 >At1g66040.1 68414.m07495 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 622 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 478 SQFKDEDNEXGEPKGKKAKMSNNAKG 555 S +E+ E EP KK KM NN+ G Sbjct: 591 SNISEEEEEESEPPTKKIKMDNNSVG 616 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 28.7 bits (61), Expect = 2.9 Identities = 17/77 (22%), Positives = 39/77 (50%), Gaps = 4/77 (5%) Frame = -3 Query: 312 RTCLDSPTFNTATGSFTASCSDMASTCIT----FNSSGLASGPNNA*RMTSLLLRGYSAF 145 + CL P+ N+A S S + +++ + N GL + + + M +++R S Sbjct: 110 KRCLSLPSSNSAKLSLVVSTTPVSAVVHSEQPKSNKDGLHASVSRSLSMNRVIVRAVSFD 169 Query: 144 ASGSHVSD*CDDERVTP 94 + +H+S+ + +++TP Sbjct: 170 DNKNHISNEANGDQITP 186 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 101 TLSSSHQSETWDPEAKAEYPRSN 169 T S H + W+P +YPRSN Sbjct: 834 TRDSLHSKQVWEPMEPKKYPRSN 856 >At5g39550.1 68418.m04791 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 617 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 478 SQFKDEDNEXGEPKGKKAKMSNNAKG 555 + +E+ E EP KK KM NN+ G Sbjct: 584 ASISEEEEEESEPPTKKIKMDNNSVG 609 >At4g33890.2 68417.m04809 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 5.1 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +2 Query: 161 RSNKLVIRQALLGPDAKPDELNVIQVEAMS-LQEAVKL-------PVAVLKVGESRHV 310 RS KL R + LGP KP L E+MS Q A +L PV V+ V E V Sbjct: 121 RSRKLRDRPSPLGPLGKPHSLTTTNEESMSKAQSATELLSLGSRPPVEVVSVEEGEEV 178 >At4g33890.1 68417.m04808 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 5.1 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +2 Query: 161 RSNKLVIRQALLGPDAKPDELNVIQVEAMS-LQEAVKL-------PVAVLKVGESRHV 310 RS KL R + LGP KP L E+MS Q A +L PV V+ V E V Sbjct: 121 RSRKLRDRPSPLGPLGKPHSLTTTNEESMSKAQSATELLSLGSRPPVEVVSVEEGEEV 178 >At1g59860.1 68414.m06742 17.6 kDa class I heat shock protein (HSP17.6A-CI) similar to 17.5 kDa class I heat shock protein SP:P04793 from [Glycine max] Length = 155 Score = 27.5 bits (58), Expect = 6.7 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = +2 Query: 125 ETWDPEAKAEYPRSNKLVIRQALLGPDAKPD-ELNVIQVEAMSL-QEAVKLPV---AVLK 289 + WDP + ++P S+ I A + D K E +V + + + +E VK+ + +VLK Sbjct: 25 DVWDPFKELQFPSSSSSAIANARV--DWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLK 82 Query: 290 VGESRHV 310 + RHV Sbjct: 83 ISGERHV 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,222,398 Number of Sequences: 28952 Number of extensions: 176081 Number of successful extensions: 456 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -