BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E18 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0190 - 21444764-21445150,21445552-21445842 34 0.11 03_06_0766 - 36106116-36106230,36106598-36106716,36106880-361069... 29 4.3 >09_06_0190 - 21444764-21445150,21445552-21445842 Length = 225 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -3 Query: 653 RWFNSNPLVPTAN*HDLYICFI-TFSISNTYDIQLNVRVAFGTFNV 519 RW N+ P V T + +LY+CF+ + SI+ Y ++L + + + T NV Sbjct: 81 RWINA-PFVRTVSVANLYLCFVRSMSIAKRYVLRLFISLKYVTANV 125 >03_06_0766 - 36106116-36106230,36106598-36106716,36106880-36106960, 36107062-36107118,36107350-36107373,36107810-36107909, 36107983-36108053,36108132-36108236,36108674-36108847, 36109406-36109555,36109701-36109871,36109968-36110024, 36110107-36110142,36110165-36110357,36110439-36110578, 36110960-36111166,36111442-36111498,36111711-36111809, 36112289-36112408,36112865-36113032,36113450-36113510, 36113611-36113720,36114132-36114263,36114344-36114511, 36115118-36115182,36115242-36115372,36115450-36115487, 36116272-36116373,36116480-36116537,36117479-36117580, 36117695-36117909,36118158-36118307,36118699-36118858, 36118984-36119042,36119287-36119443,36119536-36119681, 36121376-36121648,36122889-36122891 Length = 1457 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -1 Query: 628 FRQLINTICTYVSLRSLYQILTTY 557 + ++IN +CT +S++ LY+I T Y Sbjct: 1344 YDEIINDLCTALSVQQLYKICTQY 1367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,370,032 Number of Sequences: 37544 Number of extensions: 237972 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -