BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E18 (655 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC034923-1|AAH34923.1| 349|Homo sapiens wingless-type MMTV inte... 30 6.3 AF416743-1|AAN32640.1| 349|Homo sapiens WNT7B protein. 30 6.3 AB062766-1|BAB68399.1| 349|Homo sapiens WNT7B protein. 30 6.3 >BC034923-1|AAH34923.1| 349|Homo sapiens wingless-type MMTV integration site family, member 7B protein. Length = 349 Score = 30.3 bits (65), Expect = 6.3 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +3 Query: 78 KNLFFWVLRVYLCRNVCVKKLSASK*IISVRFNYFINY*SFLYTKNKDIAMSTPD 242 +N W+ V+LC V KL A ++++ N N L + + I S PD Sbjct: 3 RNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPD 57 >AF416743-1|AAN32640.1| 349|Homo sapiens WNT7B protein. Length = 349 Score = 30.3 bits (65), Expect = 6.3 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +3 Query: 78 KNLFFWVLRVYLCRNVCVKKLSASK*IISVRFNYFINY*SFLYTKNKDIAMSTPD 242 +N W+ V+LC V KL A ++++ N N L + + I S PD Sbjct: 3 RNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPD 57 >AB062766-1|BAB68399.1| 349|Homo sapiens WNT7B protein. Length = 349 Score = 30.3 bits (65), Expect = 6.3 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +3 Query: 78 KNLFFWVLRVYLCRNVCVKKLSASK*IISVRFNYFINY*SFLYTKNKDIAMSTPD 242 +N W+ V+LC V KL A ++++ N N L + + I S PD Sbjct: 3 RNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPD 57 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,774,304 Number of Sequences: 237096 Number of extensions: 1396274 Number of successful extensions: 1539 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1539 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -