BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E15 (346 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 25 0.60 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 0.79 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 4.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 21 9.7 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 21 9.7 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.4 bits (53), Expect = 0.60 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 10 NQQQVWDVENQKGSHHQNERLQR 78 NQQ+ W + Q+ H Q E+ Q+ Sbjct: 255 NQQREWQQQQQQQQHQQREQQQQ 277 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 25.0 bits (52), Expect = 0.79 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 111 NHEKSCEVKMDRARNT---ARIQCRVCLEDFQTTTNVLSEPI 227 N+ +SC+ + D RNT A + L F TN +S+ I Sbjct: 107 NNARSCQYQHDSCRNTPVYAWAGQNIALAQFSRMTNTISQLI 148 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 13 QQQVWDVENQKGSHHQNERLQRH 81 QQQ + Q+ HQ +LQ H Sbjct: 1311 QQQQQQQQQQQHQQHQQHQLQHH 1333 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 153 NTARIQCRVCLEDFQTTTNVLSEPIDVY 236 N R++ L+DF+ T ID Y Sbjct: 12 NLKRVEIMNTLQDFEEFTKSFDATIDAY 39 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 64 ERLQRHWISNLTARFAIMKNPAK*KWIAQ 150 ER QR W ++ R+ P +WI++ Sbjct: 852 ERWQREWDESVHGRWTYRLIPDVNRWISR 880 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 288,185 Number of Sequences: 2352 Number of extensions: 4824 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -