BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E09 (386 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 3.1 SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) 27 5.3 SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) 27 7.1 SB_50978| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) 26 9.3 SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 26 9.3 SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) 26 9.3 SB_46143| Best HMM Match : zf-CCHC (HMM E-Value=0.26) 26 9.3 SB_37473| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) 26 9.3 SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25) 26 9.3 >SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 41.1 bits (92), Expect = 3e-04 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -3 Query: 222 HWSVKAXXXXXXXXXRMRHLKIVRRRFRNGFKE 124 +WS+KA RMRHLK+V RRF+NGF+E Sbjct: 2 NWSMKAKRRTTTGTGRMRHLKLVYRRFQNGFQE 34 >SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 819 Score = 27.9 bits (59), Expect = 3.1 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 279 CDMTIYHIFCITYGSYFGA 335 CD +IYHI+ + Y ++GA Sbjct: 355 CDSSIYHIYRLKYAVHYGA 373 >SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) Length = 364 Score = 27.1 bits (57), Expect = 5.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 253 WISCSKITILPLVSEG*AQEDYWNWPHASF 164 W++C K+ +LP+ ++ Y W + F Sbjct: 136 WVNCDKVRLLPMRADEVGARVYARWTNGQF 165 >SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 27.1 bits (57), Expect = 5.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 253 WISCSKITILPLVSEG*AQEDYWNWPHASF 164 W++C K+ +LP+ ++ Y W + F Sbjct: 297 WVNCDKVRLLPMRADEVGARVYARWTNGQF 326 >SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) Length = 470 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -1 Query: 245 LQQNYDPTTGQ*RLSAGRLLELAACVI*RLSGGASVMVLKKGKPTPPK 102 +Q+ Y PT+G + L++ + GAS+ K G P P + Sbjct: 410 MQRKYSPTSGPSSYKQKKHLQVTLSSAANTTKGASLPATKSGPPVPKR 457 >SB_50978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 217 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 257 >SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) Length = 311 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 174 MRHLKIVRRRFRNGFKERETNAAQEGCS 91 M H K++ RNG ERE CS Sbjct: 222 MDHWKVLEEELRNGINEREKELEMLRCS 249 >SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 43 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 83 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 218 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 258 >SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) Length = 1238 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_46143| Best HMM Match : zf-CCHC (HMM E-Value=0.26) Length = 245 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_37473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 135 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 175 >SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) Length = 1329 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25) Length = 1186 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 333 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 214 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQVQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,313,313 Number of Sequences: 59808 Number of extensions: 187034 Number of successful extensions: 582 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -