BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_E03 (611 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 1.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 7.8 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 186 VLFCYIYKVLPVLIYHVTRNILKWH 260 ++FC +Y++L VLI N + H Sbjct: 564 IIFCSVYRILGVLILSALANRFRIH 588 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 525 LFSALTLVLRRILANPVGDCTSLXIGLYFIFLRFG 421 L L+ LR A+ +GD T + + FIF+ G Sbjct: 356 LDKTLSAFLRLNTASVMGDLTEVPVPTRFIFILLG 390 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,473 Number of Sequences: 2352 Number of extensions: 10008 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -