BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D17 (551 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 135 2e-32 At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ... 132 1e-31 At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) cont... 129 1e-30 At1g56050.1 68414.m06436 GTP-binding protein-related similar to ... 29 2.1 At1g01010.1 68414.m00001 no apical meristem (NAM) family protein... 28 3.6 At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar... 28 4.8 At5g36210.1 68418.m04365 expressed protein 27 6.3 At5g34930.1 68418.m04119 arogenate dehydrogenase identical to ar... 27 8.3 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 135 bits (327), Expect = 2e-32 Identities = 58/94 (61%), Positives = 77/94 (81%) Frame = +2 Query: 41 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 220 M++ + NR I +YLFKEGV+ AKKD++ P+H +E +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60 Query: 221 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKR 322 AW H+YW+LTNEGI++LR +L+LP EIVPATLK+ Sbjct: 61 AWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKK 94 >At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ribosomal protein S10 - Lumbricus rubellus, PID:e1329701 Length = 177 Score = 132 bits (320), Expect = 1e-31 Identities = 58/97 (59%), Positives = 78/97 (80%) Frame = +2 Query: 41 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 220 M++ + NR I +YLFKEGV AKKD++ PKH ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 221 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR 331 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAK 96 >At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) contains similarity to 40S ribosomal protein S10 Length = 179 Score = 129 bits (312), Expect = 1e-30 Identities = 57/97 (58%), Positives = 77/97 (79%) Frame = +2 Query: 41 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 220 M++ + NR I +YLFKEGV AKKD++ KH ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISEANRKEICKYLFKEGVCFAKKDFNLAKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 221 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR 331 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAK 96 >At1g56050.1 68414.m06436 GTP-binding protein-related similar to GTP-binding protein GI:10176676 from [Bacillus halodurans] Length = 421 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 393 PQQSGLGHQDDQXGPRRTVSVRTERLSVAGTISGGRCKNILK 268 PQ +G+ H D + G R +V E AG+I+ R K +L+ Sbjct: 360 PQAAGVIHSDFEKGFIRAETVAYEDFVTAGSIAAAREKGLLR 401 >At1g01010.1 68414.m00001 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] Length = 429 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 128 PKHTELEKIPNLQVIKAMQSLKSRGYVKEQ 217 P HT ++ IP+L +I+ + + K++ K+Q Sbjct: 333 PGHTRIDDIPSLNIIEPLHNYKAQEQPKQQ 362 >At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar to receptor-like protein kinase (Ipomoea nil) (U77888) Length = 1029 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 480 LEFKGGYGRGRPAS*FKQ*KNLK 548 L+F+GGY G S FK KNLK Sbjct: 178 LDFRGGYFEGSVPSSFKNLKNLK 200 >At5g36210.1 68418.m04365 expressed protein Length = 676 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 38 KMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKH 136 K++ P Q+R IYE L K+G+ VA +Y +H Sbjct: 603 KVVTPDQSR-KIYEALKKKGLPVALVEYEGEQH 634 >At5g34930.1 68418.m04119 arogenate dehydrogenase identical to arogenate dehydrogenase GI:16903098 from [Arabidopsis thaliana]; contains Pfam profile: PF02153: prephenate dehydrogenase Length = 640 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 133 LRCMIVFFGHHDSLFKEVLINSNTVLFGH 47 LR I+ FG++ E LI+ +LF H Sbjct: 53 LRIAIIGFGNYGQFLAETLISQGHILFAH 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,539,043 Number of Sequences: 28952 Number of extensions: 226043 Number of successful extensions: 570 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -