BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D13 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 28 0.20 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 27.9 bits (59), Expect = 0.20 Identities = 28/118 (23%), Positives = 58/118 (49%), Gaps = 10/118 (8%) Frame = +2 Query: 92 INDNKLIDSEMSKRRYQQ-RHNCITVIPTDE---KSPTKNFKMDTLAFTEDNYLQDEILD 259 + ++ +D++ + Y R++ + ++P ++ K KNF DTL+ + + +Q + Sbjct: 339 VGKDEQLDAKFLELPYNNSRYSLLLMVPNNKDGLKELIKNFNPDTLSTVQKSLVQMPVQI 398 Query: 260 DIKQGTIAPCSQPEKQI-KLNLKS--ERKCD---ETTKTQIHSENTLHGYCILKEKGT 415 I + I S+ EK + KL L + K D TT+ +IH + + I ++G+ Sbjct: 399 CIPKFRIDTTSRAEKPLAKLGLITMFTSKADLSGITTEQKIHVDELVQHVSIRVDEGS 456 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,409 Number of Sequences: 2352 Number of extensions: 8664 Number of successful extensions: 17 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -