BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D09 (524 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 0.71 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 0.71 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 0.71 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 0.71 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 6.7 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 8.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 8.8 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 343 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 248 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 63 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 93 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 343 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 248 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 377 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 407 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 343 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 248 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 343 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 248 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 304 CEGVTPLRLRPPKILVTVFTPT 239 C PL PP L +F PT Sbjct: 171 CNNYLPLPQVPPLPLPPIFAPT 192 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 5 FFRLPTQGKMRSVTVKDVEQD 67 +FRL T+G R V D D Sbjct: 42 YFRLTTEGDCRDVVRCDKNSD 62 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 304 CEGVTPLRLRPPKILVTVFTPT 239 C PL PP L +F PT Sbjct: 171 CNNYPPLPQVPPLPLPPIFPPT 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,952 Number of Sequences: 336 Number of extensions: 2511 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12678017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -