BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D09 (524 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 1.6 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 3.6 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 6.3 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.0 bits (52), Expect = 1.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 221 YLHSLTCWSKDCHQ 262 YLH L W CHQ Sbjct: 549 YLHGLVSWGYGCHQ 562 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 271 VGANVMELHLHISAGHQAVLHARL 342 +G M LH H GH A LHA L Sbjct: 341 MGMGSMGLHHH-HPGHHAALHAHL 363 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 6.3 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +1 Query: 307 SAGHQAVLHARLCNRWRH*SLLRKFRTVVAFSPHKVDETLTESLPXVR 450 SAG A+L+ N + L + RT++ ++ ++ +LP +R Sbjct: 324 SAGSVAILYCLAKNPEKQAKLRAELRTIMPTKDTRLTASMMSNLPYLR 371 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,338 Number of Sequences: 2352 Number of extensions: 10076 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -