BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D08 (348 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 58 1e-09 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 58 2e-09 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 32 0.091 At3g25950.1 68416.m03234 hypothetical protein 28 2.0 At5g39360.1 68418.m04768 circadian clock coupling factor-related... 26 6.0 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 6.0 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 26 6.0 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 26 6.0 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 58.4 bits (135), Expect = 1e-09 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +1 Query: 46 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLXHGSKIFKESK 180 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T K + + Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQR 66 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 83 KTAKLTEMVSKSQGRPGTNPPLXMDPKFLRNQRFCKKGNLK 205 ++AK + K R P MDPKFLRNQR+ +K N+K Sbjct: 34 QSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 74 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 58.0 bits (134), Expect = 2e-09 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLXHGSKIFKESK 180 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T K + + Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQR 44 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 83 KTAKLTEMVSKSQGRPGTNPPLXMDPKFLRNQRFCKKGNLK 205 ++AK + K R P MDPKFLRNQR+ +K N+K Sbjct: 12 QSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 32.3 bits (70), Expect = 0.091 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 61 KNHTNHNQNRKAHRNGIKKPRKTRHESTLXH 153 KNHT H++ R ++ G K RKT +T H Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKTHRNTTFGH 118 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 27.9 bits (59), Expect = 2.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 162 FGSMXKGGFVPGLPWLFDTISVSFAVLVMICMIL 61 +GS G VP WL + + FA+LV I +L Sbjct: 201 YGSGAADGVVPRWAWLSWLVVIGFAILVSILWVL 234 >At5g39360.1 68418.m04768 circadian clock coupling factor-related similar to circadian clock coupling factor ZGT [Nicotiana tabacum] GI:14210079 Length = 249 Score = 26.2 bits (55), Expect = 6.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 194 PSCKTFDSLKILDPCXRVD 138 P C+T D L + DPC +D Sbjct: 132 PQCRTDDILYVSDPCEHLD 150 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 6.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 109 YHFCELCGFGYDLYDSLTLP 50 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 26.2 bits (55), Expect = 6.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 109 YHFCELCGFGYDLYDSLTLPF**VFNP 29 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 26.2 bits (55), Expect = 6.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 109 YHFCELCGFGYDLY 68 +H E+CG G+DLY Sbjct: 33 FHHMEVCGIGHDLY 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,141,091 Number of Sequences: 28952 Number of extensions: 105142 Number of successful extensions: 338 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -