Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_D03
         (348 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY176050-1|AAO19581.1|  522|Anopheles gambiae cytochrome P450 CY...    23   4.3  
AF316638-1|AAG45166.1|  211|Anopheles gambiae glutathione S-tran...    22   5.7  

>AY176050-1|AAO19581.1|  522|Anopheles gambiae cytochrome P450
           CYP12F2 protein.
          Length = 522

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +1

Query: 166 VRTKINMGKFKKDVVKGYVIKEDDVKVAFVTL 261
           VRT +N    +   +K YV + D++   F+TL
Sbjct: 156 VRTIVNPVMMQPKTIKLYVDQVDEIAREFMTL 187


>AF316638-1|AAG45166.1|  211|Anopheles gambiae glutathione
           S-transferase D12 protein.
          Length = 211

 Score = 22.2 bits (45), Expect = 5.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +1

Query: 94  CSMEMTKYDIKNY 132
           CS++M KYD+  Y
Sbjct: 162 CSLDMMKYDLTAY 174


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 302,154
Number of Sequences: 2352
Number of extensions: 5077
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 24935070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)