BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_D01 (507 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schiz... 25 6.5 SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces pomb... 25 6.5 SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit C... 25 6.5 SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|c... 25 8.6 SPAC6G9.02c |nop9||RNA-binding protein Nop9|Schizosaccharomyces ... 25 8.6 >SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 25.0 bits (52), Expect = 6.5 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 89 STVSIK*YGPLFYLAGNVRGWVL 157 S + +K +GP +YL+ + GW L Sbjct: 99 SVLLVKKFGPHYYLSAMIIGWSL 121 >SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 25.0 bits (52), Expect = 6.5 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 123 FIWLVTFVAGFWIFKKIKEWQNLPPGPWGLPIVGYLPFIDRYHPHITLTNL 275 F+WL GFW+ + I + LP + P++G LPF Y + LT L Sbjct: 105 FVWLEVAWGGFWVSRVIA--RLLPYILY--PLMGILPF-TMYKYTVILTAL 150 >SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit Cwp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 25.0 bits (52), Expect = 6.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 428 WNYLCRRRFVEGPXEINNIV 487 WNYLC GP +++N++ Sbjct: 221 WNYLCGVLDKSGPSKLDNLI 240 >SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|chr 3|||Manual Length = 479 Score = 24.6 bits (51), Expect = 8.6 Identities = 18/65 (27%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = +2 Query: 2 LTWXRCAHF--IPIIGLYYIWLTRFNDTQLISTVSIK*YGPLFYLAGNVRGWVLDFQKNK 175 L W C +P+I +Y ++ T LI + Y L AG R W K K Sbjct: 62 LNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGLGITAGYHRLWSHRAYKAK 121 Query: 176 GMAEF 190 E+ Sbjct: 122 KPLEY 126 >SPAC6G9.02c |nop9||RNA-binding protein Nop9|Schizosaccharomyces pombe|chr 1|||Manual Length = 655 Score = 24.6 bits (51), Expect = 8.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 176 LYFFENPKPSHERYQPNKIKVHIT**IQLILVGYR 72 +Y + +P +K+ VH+ I L+L GYR Sbjct: 192 MYMYNEIRPEVSMLMSHKLAVHVLGKIFLLLDGYR 226 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,355,146 Number of Sequences: 5004 Number of extensions: 52245 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -