BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C21 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 29 0.043 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 29 0.043 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 29 0.043 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 29 0.043 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 29 0.043 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 29 0.043 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 29 0.043 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 115 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 173 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 28.7 bits (61), Expect = 0.043 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 223 TNSISQNSASNTRSQPLLVS*GKRGQMLNSMKNGQKVNGPRS*RTKKSAHK*QITIGSS 399 T++ SQN +S S S K G N+ K+GQ N P+ K H Q T+ ++ Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 218 LKPTPSHKIPPQIRVHSP 271 ++P P H PP ++H P Sbjct: 28 VQPLPRHFNPPSDKLHHP 45 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 562 YFLAGFLVAFLVRTFFAAALGIFF 491 YF+ F+ FF AL IF+ Sbjct: 53 YFIYAFVAPVKCLAFFCTALVIFY 76 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 562 YFLAGFLVAFLVRTFFAAALGIFF 491 YF+ F+ FF AL IF+ Sbjct: 286 YFIYAFVAPVKCLAFFCTALVIFY 309 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 562 YFLAGFLVAFLVRTFFAAALGIFF 491 YF+ F+ FF AL IF+ Sbjct: 286 YFIYAFVAPVKCLAFFCTALVIFY 309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,193 Number of Sequences: 336 Number of extensions: 3175 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -