BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C19 (601 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 28 0.069 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 2.0 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 6.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.9 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 27.9 bits (59), Expect = 0.069 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 595 FFITNKTYNSKSSHKYEYTNKCFKSK*TILIIFNKLNVHVDRILV 461 + +TN TYN+ ++ KY + N C + + I FN +++ +V Sbjct: 41 YLLTNLTYNN-TNRKYYWLNVCCLNLSIVTIFFNFATKKLEQFIV 84 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 137 QYCEFYQVFFKISSLMNNIFVRVDGDRCMK 48 Q CEF ++ F + L+ + +D C K Sbjct: 462 QLCEFSRLNFSVEHLLMELSRAIDSVACSK 491 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 6.0 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = -3 Query: 206 ILDKFMKHFLFRKLKWNFRYCFK-----QYCEFYQVFFKI 102 ++ F K + +L N C K +YC +Y FF + Sbjct: 84 VVTTFYKRRTWTRLLKNLESCAKIKKTKRYCYYYYAFFGV 123 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 197 KFMKHFLFRKLKWNF 153 +F+KH L KWNF Sbjct: 1498 RFIKHVLQFLEKWNF 1512 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,628 Number of Sequences: 336 Number of extensions: 2672 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -