BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C19 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) 27 8.8 >SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 291 FYVFTYCYIIYTCCINVSGLFLDDRVPKYF 380 ++ F CY+ C ++ L D RV YF Sbjct: 257 YFAFVICYLPILCSVSYDALTNDHRVSAYF 286 >SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) Length = 355 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 589 ITNKTYNSKSSHKYEYTNKCFK 524 + NK +N+ S KY++ N CF+ Sbjct: 78 VRNKAFNAIKSAKYKFYNSCFE 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,564,794 Number of Sequences: 59808 Number of extensions: 254067 Number of successful extensions: 473 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -