BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C18 (489 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0487 + 16471538-16471540,16471694-16471795,16471880-164719... 133 8e-32 02_03_0220 + 16545571-16545573,16545717-16545818,16545980-165460... 59 2e-09 04_03_0796 + 19721379-19721381,19721479-19721580,19722558-19722590 57 9e-09 04_04_0303 + 24269467-24270741 31 0.38 02_01_0418 - 3059575-3061279,3061915-3061973,3064270-3064353,306... 27 6.1 01_05_0607 + 23619271-23619426,23619479-23619552,23619917-236205... 27 6.1 03_02_0238 - 6687334-6687421,6687456-6687512,6688266-6688351,668... 27 8.1 >04_03_0487 + 16471538-16471540,16471694-16471795,16471880-16471908, 16472619-16472745 Length = 86 Score = 133 bits (321), Expect = 8e-32 Identities = 58/78 (74%), Positives = 65/78 (83%) Frame = +1 Query: 52 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 231 IDLL+P E+ KHK KRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC GC T+LC Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPGCQTVLC 66 Query: 232 QPTGGRARLTEGCSFRRK 285 QPTGG+ARLTEGCSFRRK Sbjct: 67 QPTGGKARLTEGCSFRRK 84 >02_03_0220 + 16545571-16545573,16545717-16545818,16545980-16546008, 16549421-16553036 Length = 1249 Score = 58.8 bits (136), Expect = 2e-09 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +1 Query: 52 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHA 189 IDLL+P E+ KHK KRLV PNS+FMDVKC GC+ ++ F A Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNMSVRFDIA 52 >04_03_0796 + 19721379-19721381,19721479-19721580,19722558-19722590 Length = 45 Score = 56.8 bits (131), Expect = 9e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 52 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKI 168 IDLL+P E+ KHK KRLV PNS+FMDVKC GC+ + Sbjct: 7 IDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSM 45 >04_04_0303 + 24269467-24270741 Length = 424 Score = 31.5 bits (68), Expect = 0.38 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = +1 Query: 49 AIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTIL 228 A+ LLHP L ++PH S +D CP Y+I ++ RVV C+++ Sbjct: 148 AVRLLHPFTGDTAELPPLGTVLPHLGSRLLD--CPAPYRIRSL----ARVV----CASVS 197 Query: 229 CQPTGGRA 252 C TG A Sbjct: 198 CSATGAGA 205 >02_01_0418 - 3059575-3061279,3061915-3061973,3064270-3064353, 3064395-3064559 Length = 670 Score = 27.5 bits (58), Expect = 6.1 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +1 Query: 31 AVTMPLAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSH 186 AV L L+ + ASERRK K+ L N + + YK V SH Sbjct: 51 AVPRSLEAKLMVKTLASERRKRKVNNLERKGNKVDVSIAANDYYKPRAVKSH 102 >01_05_0607 + 23619271-23619426,23619479-23619552,23619917-23620594, 23620711-23620815,23620877-23621003,23621613-23621773, 23621858-23622028,23622195-23622324,23622532-23622747, 23626821-23627348 Length = 781 Score = 27.5 bits (58), Expect = 6.1 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -1 Query: 183 TKNCCNLVTARALNIHEIRVRMWH*PLKLMFPPLRRRGRMQQINCERHGYSFNAQPEKPT 4 T +CC + A L+ E RV + PL+++ L RG + Q+N G S + P Sbjct: 679 TAHCCFICRAGVLSAGECRVAVGVDPLEVL-DRLPDRGAVHQMNRREAGNSTRSTVRAPK 737 Query: 3 I 1 + Sbjct: 738 L 738 >03_02_0238 - 6687334-6687421,6687456-6687512,6688266-6688351, 6688410-6688589 Length = 136 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 157 CYKITTVFSHAQRVVVCAGCSTILCQPTGGR 249 CYKI+ ++SH Q ++ C IL +PTG R Sbjct: 96 CYKISKIYSHGQSLL----CLDIL-RPTGRR 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,561,875 Number of Sequences: 37544 Number of extensions: 215824 Number of successful extensions: 511 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -