BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C17 (357 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) 38 3e-04 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) 27 3.4 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 26 7.8 >SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) Length = 92 Score = 37.5 bits (83), Expect(2) = 3e-04 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +1 Query: 103 TGKVKVPEHMDLVKTARFKELAPX*P 180 +G +K+P+ +DLVKT +FKELAP P Sbjct: 2 SGNLKIPDWVDLVKTGKFKELAPYDP 27 Score = 22.6 bits (46), Expect(2) = 3e-04 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 265 IFGGRKRNGVTPSHF 309 I GRK G PSHF Sbjct: 32 IRAGRKNRGSAPSHF 46 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.9 bits (59), Expect = 2.6 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 54 C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDS 149 C QDC + RC +KNG + T A G CK S Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGS 331 >SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) Length = 650 Score = 27.5 bits (58), Expect = 3.4 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 214 FVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCRVIRQYCTQXLCN 351 FV T H + +T+ F + G P FCR + T+ +C+ Sbjct: 163 FVTNTHHHRFSSRALTRPFCFKNTTGTKPKFFCRPLNVPETKHICS 208 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 26.2 bits (55), Expect = 7.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 258 DSLDSXQVSECKYDEGWQHNAHRTNXG 178 DS+ +V+ CK +E W + H T G Sbjct: 996 DSVSGKEVTSCKKNETWIADCHFTRDG 1022 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,750,287 Number of Sequences: 59808 Number of extensions: 187573 Number of successful extensions: 491 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -