BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C17 (357 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M81757-1|AAA89070.1| 145|Homo sapiens S19 ribosomal protein pro... 83 2e-16 BC018616-1|AAH18616.1| 145|Homo sapiens ribosomal protein S19 p... 83 2e-16 BC007615-1|AAH07615.1| 145|Homo sapiens ribosomal protein S19 p... 83 2e-16 BC000023-1|AAH00023.1| 145|Homo sapiens ribosomal protein S19 p... 83 2e-16 AF092907-1|AAD13668.1| 145|Homo sapiens ribosomal protein S19 p... 83 2e-16 BC017386-1|AAH17386.1| 157|Homo sapiens ribosomal protein S19 p... 82 6e-16 Z97055-5|CAB09789.1| 429|Homo sapiens protein ( Human DNA seque... 30 2.4 BC104843-1|AAI04844.1| 429|Homo sapiens patatin-like phospholip... 30 2.4 BC104839-1|AAI04840.1| 429|Homo sapiens patatin-like phospholip... 30 2.4 BC031820-1|AAH31820.1| 429|Homo sapiens patatin-like phospholip... 30 2.4 AK127172-1|BAC86866.1| 315|Homo sapiens protein ( Homo sapiens ... 30 2.4 AF460563-1|AAM87934.1| 68|Homo sapiens immunoglobulin heavy ch... 29 5.6 BC018698-1|AAH18698.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA pro... 28 9.8 BC018665-1|AAH18665.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA pro... 28 9.8 BC008719-1|AAH08719.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA pro... 28 9.8 AJ131186-1|CAB51857.1| 504|Homo sapiens nuclear matrix protein ... 28 9.8 >M81757-1|AAA89070.1| 145|Homo sapiens S19 ribosomal protein protein. Length = 145 Score = 83.0 bits (196), Expect = 2e-16 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +1 Query: 31 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLP 210 M VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP Sbjct: 1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST 60 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 + ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 61 ARHLYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 94 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 52 WFYTRAASTARHLYLR 67 >BC018616-1|AAH18616.1| 145|Homo sapiens ribosomal protein S19 protein. Length = 145 Score = 83.0 bits (196), Expect = 2e-16 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +1 Query: 31 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLP 210 M VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP Sbjct: 1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST 60 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 + ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 61 ARHLYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 94 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 52 WFYTRAASTARHLYLR 67 >BC007615-1|AAH07615.1| 145|Homo sapiens ribosomal protein S19 protein. Length = 145 Score = 83.0 bits (196), Expect = 2e-16 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +1 Query: 31 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLP 210 M VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP Sbjct: 1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST 60 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 + ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 61 ARHLYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 94 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 52 WFYTRAASTARHLYLR 67 >BC000023-1|AAH00023.1| 145|Homo sapiens ribosomal protein S19 protein. Length = 145 Score = 83.0 bits (196), Expect = 2e-16 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +1 Query: 31 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLP 210 M VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP Sbjct: 1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST 60 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 + ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 61 ARHLYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 94 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 52 WFYTRAASTARHLYLR 67 >AF092907-1|AAD13668.1| 145|Homo sapiens ribosomal protein S19 protein. Length = 145 Score = 83.0 bits (196), Expect = 2e-16 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +1 Query: 31 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLP 210 M VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP Sbjct: 1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST 60 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 + ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 61 ARHLYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 94 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 52 WFYTRAASTARHLYLR 67 >BC017386-1|AAH17386.1| 157|Homo sapiens ribosomal protein S19 protein. Length = 157 Score = 81.8 bits (193), Expect = 6e-16 Identities = 45/92 (48%), Positives = 59/92 (64%) Frame = +1 Query: 40 VTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*PXIGSMCVVLPSFV 219 VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAP + Sbjct: 16 VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARH 75 Query: 220 IFTFAHLXGVKTVTKIFGGRKRNGVTPSHFCR 315 ++ GV ++TKI+GGR+RNGV PSHF R Sbjct: 76 LYLRGG-AGVGSMTKIYGGRQRNGVMPSHFSR 106 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 186 WFYVRCAAILRHIYIR 233 WFY R A+ RH+Y+R Sbjct: 64 WFYTRAASTARHLYLR 79 >Z97055-5|CAB09789.1| 429|Homo sapiens protein ( Human DNA sequence from clone RP3-388M5 on chromosome 22. ). Length = 429 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 162 AGSXMTLXWFYVRCAAILRHIYIRSPX---WSQDCHQDLWWAQ 281 +G L + + C +IY RS W D DLWW Q Sbjct: 335 SGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377 >BC104843-1|AAI04844.1| 429|Homo sapiens patatin-like phospholipase domain containing 5 protein. Length = 429 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 162 AGSXMTLXWFYVRCAAILRHIYIRSPX---WSQDCHQDLWWAQ 281 +G L + + C +IY RS W D DLWW Q Sbjct: 335 SGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377 >BC104839-1|AAI04840.1| 429|Homo sapiens patatin-like phospholipase domain containing 5 protein. Length = 429 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 162 AGSXMTLXWFYVRCAAILRHIYIRSPX---WSQDCHQDLWWAQ 281 +G L + + C +IY RS W D DLWW Q Sbjct: 335 SGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377 >BC031820-1|AAH31820.1| 429|Homo sapiens patatin-like phospholipase domain containing 5 protein. Length = 429 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 162 AGSXMTLXWFYVRCAAILRHIYIRSPX---WSQDCHQDLWWAQ 281 +G L + + C +IY RS W D DLWW Q Sbjct: 335 SGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377 >AK127172-1|BAC86866.1| 315|Homo sapiens protein ( Homo sapiens cDNA FLJ45237 fis, clone BRCAN2028702. ). Length = 315 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 162 AGSXMTLXWFYVRCAAILRHIYIRSPX---WSQDCHQDLWWAQ 281 +G L + + C +IY RS W D DLWW Q Sbjct: 221 SGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQ 263 >AF460563-1|AAM87934.1| 68|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 68 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 277 RKRNGVTPSHFCRVIRQYCTQXLCNRW 357 R R+ T ++C + +YCT +C W Sbjct: 36 RLRSDDTAVYYCARVERYCTNGICYNW 62 >BC018698-1|AAH18698.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) protein. Length = 504 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 10 RLSTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTA 150 ++ T G ++V V D ++I+ T+ H KK V DLV +A Sbjct: 236 KILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSA 282 >BC018665-1|AAH18665.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) protein. Length = 504 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 10 RLSTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTA 150 ++ T G ++V V D ++I+ T+ H KK V DLV +A Sbjct: 236 KILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSA 282 >BC008719-1|AAH08719.1| 504|Homo sapiens PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) protein. Length = 504 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 10 RLSTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTA 150 ++ T G ++V V D ++I+ T+ H KK V DLV +A Sbjct: 236 KILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSA 282 >AJ131186-1|CAB51857.1| 504|Homo sapiens nuclear matrix protein NMP200 protein. Length = 504 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 10 RLSTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTA 150 ++ T G ++V V D ++I+ T+ H KK V DLV +A Sbjct: 236 KILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSA 282 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,891,852 Number of Sequences: 237096 Number of extensions: 921467 Number of successful extensions: 1721 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2133208582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -