BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C17 (357 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81586-2|CAB04689.1| 146|Caenorhabditis elegans Hypothetical pr... 73 4e-14 AF016512-1|AAB69445.1| 146|Caenorhabditis elegans ribosomal pro... 73 4e-14 AF068708-7|AAC17760.1| 365|Caenorhabditis elegans Hypothetical ... 27 2.9 Z93388-14|CAN86927.1| 226|Caenorhabditis elegans Hypothetical p... 26 8.9 Z93388-13|CAB07666.1| 383|Caenorhabditis elegans Hypothetical p... 26 8.9 >Z81586-2|CAB04689.1| 146|Caenorhabditis elegans Hypothetical protein T05F1.3 protein. Length = 146 Score = 73.3 bits (172), Expect = 4e-14 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 1/93 (1%) Frame = +1 Query: 34 RSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*P-XIGSMCVVLP 210 R+ ++KDV+Q + K++A LKK+GKVKVPE DLVK KELAP P + L Sbjct: 3 RATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDPDWFYTRAASLA 62 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHF 309 + F A G+ K++GG KR GV P+HF Sbjct: 63 RHLYFRPA---GIGAFKKVYGGNKRRGVAPNHF 92 >AF016512-1|AAB69445.1| 146|Caenorhabditis elegans ribosomal protein S19 protein. Length = 146 Score = 73.3 bits (172), Expect = 4e-14 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 1/93 (1%) Frame = +1 Query: 34 RSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPX*P-XIGSMCVVLP 210 R+ ++KDV+Q + K++A LKK+GKVKVPE DLVK KELAP P + L Sbjct: 3 RATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDPDWFYTRAASLA 62 Query: 211 SFVIFTFAHLXGVKTVTKIFGGRKRNGVTPSHF 309 + F A G+ K++GG KR GV P+HF Sbjct: 63 RHLYFRPA---GIGAFKKVYGGNKRRGVAPNHF 92 >AF068708-7|AAC17760.1| 365|Caenorhabditis elegans Hypothetical protein C18G1.8 protein. Length = 365 Score = 27.5 bits (58), Expect = 2.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 218 SYLHSLTXLESRLSPRSLVGANVMEL 295 S H + SRLSPRS +G N+ E+ Sbjct: 67 STFHPEKYISSRLSPRSRLGNNIFEM 92 >Z93388-14|CAN86927.1| 226|Caenorhabditis elegans Hypothetical protein T10C6.10b protein. Length = 226 Score = 25.8 bits (54), Expect = 8.9 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -2 Query: 155 KRAVFTRSMCSGTLTLPVFFK*AATVLTILSCSTSFTVTERILPCVD 15 KRAVF R++ G L LP+ + T CST E + PC+D Sbjct: 99 KRAVFNRTVKFGDLRLPMKY----DPKTRYHCSTDI-YEECLQPCLD 140 >Z93388-13|CAB07666.1| 383|Caenorhabditis elegans Hypothetical protein T10C6.10a protein. Length = 383 Score = 25.8 bits (54), Expect = 8.9 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -2 Query: 155 KRAVFTRSMCSGTLTLPVFFK*AATVLTILSCSTSFTVTERILPCVD 15 KRAVF R++ G L LP+ + T CST E + PC+D Sbjct: 99 KRAVFNRTVKFGDLRLPMKY----DPKTRYHCSTDI-YEECLQPCLD 140 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,742,824 Number of Sequences: 27780 Number of extensions: 139327 Number of successful extensions: 382 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 482051610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -