BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C16 (550 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP31B10.08c |rpl35a|rpl33|60S ribosomal protein L35a|Schizosac... 105 6e-24 SPBC1921.01c |rpl3701|rpl37-1, rpl37|60S ribosomal protein L37|S... 103 2e-23 SPBP4G3.02 |pho1||acid phosphatase Pho1 |Schizosaccharomyces pom... 27 1.8 SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schiz... 25 9.7 >SPCP31B10.08c |rpl35a|rpl33|60S ribosomal protein L35a|Schizosaccharomyces pombe|chr 3|||Manual Length = 108 Score = 105 bits (251), Expect = 6e-24 Identities = 53/115 (46%), Positives = 70/115 (60%), Gaps = 1/115 (0%) Frame = +2 Query: 167 PRHG-RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTP 343 P G RLY KA ++R H T+++K+EG + +A FY GK YVY++ K Sbjct: 2 PAQGHRLYVKAKHLSFQRSKHVIHPGTSIVKIEGCDSKEEAQFYLGKRVCYVYKSSKAV- 60 Query: 344 IPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 508 RG +K+R IWG + RPHGNSG+VRA+F NLPA+ G +RVMLYPS I Sbjct: 61 -----RG--SKIRVIWGTIARPHGNSGAVRARFVHNLPAKTFGSSLRVMLYPSNI 108 >SPBC1921.01c |rpl3701|rpl37-1, rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 2|||Manual Length = 108 Score = 103 bits (246), Expect = 2e-23 Identities = 52/115 (45%), Positives = 70/115 (60%), Gaps = 1/115 (0%) Frame = +2 Query: 167 PRHG-RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTP 343 P G RLY KA ++R H T+L+K+EG + +A FY GK +VY++ K P Sbjct: 2 PAQGHRLYVKAKHLSFQRSKHVIHPGTSLVKIEGCDSKEEAQFYLGKRICFVYKSNK--P 59 Query: 344 IPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 508 + G +K+R IWG V+RPHGNSG VRA+F NLP + G +RVMLYPS + Sbjct: 60 VRG------SKIRVIWGTVSRPHGNSGVVRARFTHNLPPKTFGASLRVMLYPSNV 108 >SPBP4G3.02 |pho1||acid phosphatase Pho1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 453 Score = 27.1 bits (57), Expect = 1.8 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 400 HLAPDSTQLGFFATGTSGNWCPLLSSVHIDAMLAS 296 ++ P T LGFF T N P VH +M AS Sbjct: 333 NIIPVETALGFFTDNTPENPLPTSYQVHSHSMKAS 367 >SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1473 Score = 24.6 bits (51), Expect = 9.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 402 PAHMATLAVSEPSSSLTSLPRLWDTEY 482 P L V EP +TSLPR WD Y Sbjct: 308 PTSTKRLTVLEP---ITSLPRKWDPLY 331 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,135,673 Number of Sequences: 5004 Number of extensions: 42061 Number of successful extensions: 102 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -