BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C14 (586 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 32 0.054 SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharom... 27 1.5 SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces pom... 27 2.7 SPCC645.11c |mug117||meiotically upregulated gene Mug117|Schizos... 26 4.7 SPBC1773.14 |arg7||argininosuccinate lyase |Schizosaccharomyces ... 25 6.2 SPCC1259.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 25 6.2 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 32.3 bits (70), Expect = 0.054 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 Query: 299 TKLLSHPLEPRRDRCVLLEQRLLSSERVIRKWIQ 198 +KL+S P P R RC LLE +E W+Q Sbjct: 494 SKLVSEPEPPIRSRCALLENMFNPAEETSPNWVQ 527 >SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharomyces pombe|chr 3|||Manual Length = 1690 Score = 27.5 bits (58), Expect = 1.5 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +3 Query: 66 NKIKYKMAAVQGPPGNKQWPARPGLQHQISQNPSMNLTLNRSI-NLYPLTNYTFGTKEPL 242 +KI+ ++ + +K P + H++S + L++ SI N+ P F KEP Sbjct: 919 DKIRVRVLGIHDSRNHKFLP----ISHRVSPKQFLELSVRPSILNMEP-----FSMKEPQ 969 Query: 243 FEKDASVPARFQRMREEFCKIGMRRSVEG 329 F+K V + +E + + SV G Sbjct: 970 FKKGDEVTGFVNNVSKECVWVSLTPSVNG 998 >SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 682 Score = 26.6 bits (56), Expect = 2.7 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -2 Query: 390 TPCRVAVTAHEV--DHVHVLITHLQLTFSFRFYKTPLASSGTSP 265 TPC A D LIT++Q+ S YK+P A +P Sbjct: 544 TPCNSEEEARSYFKDGTDSLITNIQIRTSLNRYKSPQAPQNVNP 587 >SPCC645.11c |mug117||meiotically upregulated gene Mug117|Schizosaccharomyces pombe|chr 3|||Manual Length = 186 Score = 25.8 bits (54), Expect = 4.7 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +3 Query: 132 PGLQHQISQNPSMNLTLNRSINLYPLTNYTFGTKEPLFEKDASVPARF-QRMREEFCKIG 308 P L+ + P+ + NRS+ + ++YT + ++E + PAR + +EF ++ Sbjct: 77 PMLRGENRACPNAYMKYNRSLIYHGYSSYTASSCTAIYECEGDYPARTGNEIIDEFDQLN 136 Query: 309 MRRSVEG 329 ++ S G Sbjct: 137 LQCSACG 143 >SPBC1773.14 |arg7||argininosuccinate lyase |Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 25.4 bits (53), Expect = 6.2 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 144 HQISQNPSMNLTLNRSINLYPLTNYTFGTKEPLFEKDASVPARFQRMREEFCKIG 308 H IS + ++ + R+ L L+ + PLF++D S ++ E+ C IG Sbjct: 389 HHISGS-AVRMAEERNTTLDKLSVSDLQSLHPLFDEDVSKVFNYEESVEKRCSIG 442 >SPCC1259.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 168 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 102 PPGNKQWPARPGLQHQISQNPSMNLTLNRSI 194 PPG+ W A+P ++PS TL + I Sbjct: 68 PPGSPYWEAKPVSHTVFLESPSDVFTLEKPI 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,307,383 Number of Sequences: 5004 Number of extensions: 45154 Number of successful extensions: 102 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -