BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C11 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 24 3.7 AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein pro... 24 3.7 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = +2 Query: 443 SDSIEKSTVESTLQKENSSQTEK--TVL---NITDDKGENDKDNTLEDNEKT 583 S S +S Q+++S Q ++ T+L N+++ +GEN TL+D T Sbjct: 132 SHSQHSQQQQSPQQQQSSQQLQQPLTILVPKNLSNSQGENSVTYTLDDLSNT 183 >AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein protein. Length = 182 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +2 Query: 455 EKSTVESTLQKENSSQTEKTVLNITDDKGENDKDNTLEDNEKTKKPSKSITDSSTWGEYA 634 + S ++S +++ ++ DD+ E KD+ ED+E+ + GE Sbjct: 100 DDSEMDSAMKEGEEGAGSDDAVSGADDETEESKDDAEEDSEEGGEEGGDSASGGEGGEKE 159 Query: 635 S 637 S Sbjct: 160 S 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,665 Number of Sequences: 2352 Number of extensions: 10342 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -