BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_C05 (656 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 26 0.91 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 24 3.7 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 24 3.7 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 24 3.7 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 24 3.7 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 24 3.7 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 24 4.9 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 24 4.9 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 6.4 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 23 8.5 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 23 8.5 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 8.5 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 26.2 bits (55), Expect = 0.91 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 99 LLVRSLSTSVASAQMVKPPVQVFGLEGRYASALFSAASKTKALD---IVEKELCQFQQSI 269 L++ S+ + + A+MVK Q G +GR + D V K+L + +S Sbjct: 36 LVLHSMLVNASLAEMVKESYQTHGADGRMVVRMLKFVRLLPGADERVAVYKQLAELLKSN 95 Query: 270 KTDAKLKEFIINPTIKR 320 D + I + +++ Sbjct: 96 GQDGRFPAVIFSTDVRQ 112 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNIVANAGSNG 59 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNIVANAGSNG 59 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 26 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 61 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 413 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 385 LPVVGERLILLATCFNASTFMLLFIVGLMMNSLSF 281 LP V + + LL T FN FM+ V L + L++ Sbjct: 284 LPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNY 318 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 8.5 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENGRLGKLEAVIN 443 P K S +A AN ++ + T GN + NG + A N Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNSVANAGSNGTGNNVIAATN 69 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 8.5 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +3 Query: 306 PTIKRSMKVDALKHVANKISLSPTTGNLLGLLAENGRLGKLEAVIN 443 P K S +A AN ++ + T GN + NG + A N Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNSVANAGSNGTGNNVIAATN 69 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 379 VVGERLILLATCFNASTFMLLF 314 ++ RL+ L CFN TF+ F Sbjct: 41 ILALRLVTLLPCFNVLTFISSF 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,113 Number of Sequences: 2352 Number of extensions: 14396 Number of successful extensions: 82 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -