BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B22 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.5 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.5 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.5 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.9 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 6.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 7.9 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 7.9 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.9 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 7.9 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 238 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 390 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 238 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 390 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 238 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 390 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 238 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 390 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 238 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 390 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 286 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 338 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = -2 Query: 636 CNTLCDCFNISECSLTCTCAQKPDCLVD 553 C LC C + C TC C D Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 217 ETYQRLAHRSNSICRKA*FQECRRLVVKTWFP 122 + Y+RL H N I ++ F RL T+ P Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCP 271 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 388 IVKHAFEIIHLLTGENPLQVLVTAII 465 +++HAFEI +L P+ +++ I Sbjct: 217 LIEHAFEISTMLFFVLPMTIIIVLYI 242 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 356 RPCIIREFVRRSTIGHWAL 300 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 356 RPCIIREFVRRSTIGHWAL 300 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 356 RPCIIREFVRRSTIGHWAL 300 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 338 EFVRRSTIGHWALRKRLCAYLPAE 267 EF R T AL K+LC PAE Sbjct: 585 EFPRSITRNATALIKKLCRDNPAE 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,642 Number of Sequences: 438 Number of extensions: 3641 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -