BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B18 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,813... 32 0.35 03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660... 32 0.35 10_08_0043 - 14390398-14391531,14391850-14393691,14393800-143968... 30 1.9 03_05_0211 - 22020515-22020687,22020801-22020831,22022060-220221... 29 3.3 09_06_0082 + 20749425-20749589,20750137-20750238,20750320-207503... 29 4.3 07_03_0018 - 12490940-12491195,12491575-12491775,12492174-124924... 29 4.3 04_03_0498 + 16574250-16574312,16576576-16577457,16578624-165787... 29 4.3 03_06_0449 - 34013973-34014056,34014595-34014630,34014729-340148... 29 4.3 02_03_0287 + 17320242-17320481,17323422-17324767,17325124-17325142 28 7.5 >06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088, 8135179-8135256,8135442-8135697,8136427-8136515, 8137229-8137376,8137460-8137899,8138048-8138562, 8138791-8139061,8139231-8139492,8139583-8139938 Length = 1004 Score = 32.3 bits (70), Expect = 0.35 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 511 PTKRKRIRLNPVDSDDSDVENKADNKIGTT 600 P R+R R +P SDDSD++ + DN T+ Sbjct: 915 PPSRRRARRSPSSSDDSDIDGQEDNLHATS 944 >03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048, 13266361-13266623,13267637-13267847,13268420-13268590, 13268671-13268748,13269275-13269520,13269763-13271868, 13272122-13273904,13274113-13274216,13274752-13275108, 13275210-13275328,13276175-13276436,13276669-13276893, 13277075-13277214,13278087-13278159,13278431-13278532, 13278647-13279018,13279183-13279230,13279516-13279900, 13280440-13280558 Length = 2574 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 367 LLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEE 495 LLK+ I P S K +ENK + T SP K SS E+ Sbjct: 1589 LLKVSIKKTPEPSISKDAQVENKSLHMKATDSPGKNKTSSTEK 1631 >10_08_0043 - 14390398-14391531,14391850-14393691,14393800-14396825, 14397510-14397609 Length = 2033 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = +1 Query: 442 ERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573 E + L S +E ++L TK+ +++L+ V++ ++D+EN Sbjct: 757 EAALLAMTNLNSESQEEVNRLTLETKKLKVKLSEVENSNTDLEN 800 >03_05_0211 - 22020515-22020687,22020801-22020831,22022060-22022169, 22022715-22023102,22023344-22023397,22023739-22023849, 22023956-22024015,22024618-22024694,22026155-22026188, 22026267-22027235 Length = 668 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 385 VMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSD 564 + P+ + +KG + ++KR+R TP KK D++ I+ KR + D D+ D Sbjct: 408 IPTPKANIRKGSN--SRKRKRGSTPKSSSKKFDDDDD--ITPSKKRNKALEYDTDEDEDD 463 Query: 565 VE-NKADNK 588 + K+D++ Sbjct: 464 ADPMKSDSE 472 >09_06_0082 + 20749425-20749589,20750137-20750238,20750320-20750384, 20750471-20750588,20750937-20751012,20751304-20751365, 20751457-20751588,20751686-20751739,20751969-20752034, 20752115-20752189,20752271-20752321 Length = 321 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +1 Query: 409 KKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582 +K +++ K E + +L+K +EEE+ K++R+R +P S ++EN +D Sbjct: 88 EKRVNIRTKIEEEE---KEKLQKLQQEEEELQMQKRKKRRVRGDPRLSFCDEIENGSD 142 >07_03_0018 - 12490940-12491195,12491575-12491775,12492174-12492403, 12492624-12492744,12492823-12492972,12493106-12493314, 12494120-12494234,12494346-12494440,12494523-12494758, 12496182-12496338 Length = 589 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +2 Query: 236 YNKRRYDSYSNYNNVETK--QHRGSQYSFQLFY 328 Y+ +YDS ++ +++ K QH GS+ S +LFY Sbjct: 179 YHSGQYDSEEHFMDLDKKLKQHEGSRVSNRLFY 211 >04_03_0498 + 16574250-16574312,16576576-16577457,16578624-16578714, 16578802-16578857,16579527-16579640 Length = 401 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 330 KTPPTNKKLKADATEDTDCNGSPKKQ*KRNTS*KQKTRKANYTLT 464 +T P K + + C G+P+ KR + K+ R+A+Y T Sbjct: 261 ETVPNEDKTPCTSLDVRGCEGTPRASLKRRVNKKRTKREASYPTT 305 >03_06_0449 - 34013973-34014056,34014595-34014630,34014729-34014816, 34015034-34015143,34015611-34015715,34015812-34015903, 34016145-34016232,34016407-34016526,34016603-34016721, 34017253-34018126 Length = 571 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 472 KKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573 K SD EE + P KRKR++L+P D+ + +E+ Sbjct: 253 KDPVSDIEETLP-PKKRKRMKLDPYDTSNKRLED 285 >02_03_0287 + 17320242-17320481,17323422-17324767,17325124-17325142 Length = 534 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 273 TMSKRNSTGAANTLFNYFTKTPPTNKKLKADATEDTDCN 389 T ++ + G N +F ++T TPP + +DT C+ Sbjct: 134 TTARGLTRGGKNIVFTFWTATPPRASFFTLHSPDDTKCS 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,774,979 Number of Sequences: 37544 Number of extensions: 221784 Number of successful extensions: 639 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -